BLASTX nr result
ID: Rehmannia22_contig00012652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00012652 (337 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494482.1| PREDICTED: tRNA-dihydrouridine(16/17) syntha... 59 5e-07 ref|XP_006425966.1| hypothetical protein CICLE_v10025630mg [Citr... 59 5e-07 gb|EXB54186.1| tRNA-dihydrouridine synthase 1-like protein [Moru... 59 7e-07 ref|XP_002533266.1| tRNA-dihydrouridine synthase, putative [Rici... 57 3e-06 gb|EMJ06485.1| hypothetical protein PRUPE_ppa006605mg [Prunus pe... 56 6e-06 >ref|XP_006494482.1| PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Citrus sinensis] Length = 436 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 335 DLNAQNKLTFEFLYGIVDRLRGLGGRIPLFVKDSSRCELSAN 210 DLNAQN+LTFEFLY +VDRLR LG RIPL+ KD+ E+ A+ Sbjct: 391 DLNAQNRLTFEFLYNLVDRLRELGVRIPLYKKDTDDAEILAD 432 >ref|XP_006425966.1| hypothetical protein CICLE_v10025630mg [Citrus clementina] gi|557527956|gb|ESR39206.1| hypothetical protein CICLE_v10025630mg [Citrus clementina] Length = 436 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 335 DLNAQNKLTFEFLYGIVDRLRGLGGRIPLFVKDSSRCELSAN 210 DLNAQN+LTFEFLY +VDRLR LG RIPL+ KD+ E+ A+ Sbjct: 391 DLNAQNRLTFEFLYNLVDRLRELGVRIPLYKKDADDAEILAD 432 >gb|EXB54186.1| tRNA-dihydrouridine synthase 1-like protein [Morus notabilis] Length = 404 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 335 DLNAQNKLTFEFLYGIVDRLRGLGGRIPLFVKDSSRCELSANG 207 +LNAQ+KLTFEFLYG+VDRL LG RIPL+ KDS +S NG Sbjct: 356 ELNAQSKLTFEFLYGLVDRLGELGVRIPLYQKDSLAAGVSQNG 398 >ref|XP_002533266.1| tRNA-dihydrouridine synthase, putative [Ricinus communis] gi|223526922|gb|EEF29128.1| tRNA-dihydrouridine synthase, putative [Ricinus communis] Length = 426 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = -3 Query: 335 DLNAQNKLTFEFLYGIVDRLRGLGGRIPLFVK--DSSRCELSANG 207 +LNAQ++LTFEFLY +VD+LR LG RIPL+VK D+S ++ANG Sbjct: 379 ELNAQSRLTFEFLYNVVDQLRALGVRIPLYVKDLDTSATGVAANG 423 >gb|EMJ06485.1| hypothetical protein PRUPE_ppa006605mg [Prunus persica] Length = 403 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 335 DLNAQNKLTFEFLYGIVDRLRGLGGRIPLFVKDSSRCELSANG 207 DLNAQ+ LTFEFLY IVDRLR LG IPL +K+++ + ANG Sbjct: 358 DLNAQSILTFEFLYSIVDRLRELGAGIPLHLKETNAATICANG 400