BLASTX nr result
ID: Rehmannia22_contig00012436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00012436 (764 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352672.1| PREDICTED: SKI family transcriptional corepr... 59 1e-06 >ref|XP_006352672.1| PREDICTED: SKI family transcriptional corepressor 2-like [Solanum tuberosum] Length = 148 Score = 59.3 bits (142), Expect = 1e-06 Identities = 37/93 (39%), Positives = 46/93 (49%), Gaps = 9/93 (9%) Frame = +2 Query: 113 NCPLHRSILQPNNHXXXXXXXXXXXXXQNPQPLA-SIPPD--------PHFSFVGDDAQM 265 NCP H +LQ N H QNP+ + S+ PD P+ SF +D+ M Sbjct: 30 NCPFHSYMLQRNKHGPTCPLFTPSPLPQNPEQITPSLLPDDLNMQISEPNVSF--NDSGM 87 Query: 266 MQDGTXXXXXXXXXXXPIFVLTDEWREFFAKSE 364 MQ+ PIFVLTDEWR+FFAKSE Sbjct: 88 MQNEGENFEDEDEEEEPIFVLTDEWRDFFAKSE 120