BLASTX nr result
ID: Rehmannia22_contig00011740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00011740 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY28131.1| Vascular plant one zinc finger protein isoform 1 ... 70 2e-10 dbj|BAJ07177.1| MdVOZ1 [Malus domestica] 70 4e-10 gb|EMJ15159.1| hypothetical protein PRUPE_ppa004946mg [Prunus pe... 68 1e-09 emb|CBI30629.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002273268.1| PREDICTED: uncharacterized protein LOC100243... 65 1e-08 ref|XP_002305772.1| hypothetical protein POPTR_0004s05030g [Popu... 64 3e-08 ref|XP_004232932.1| PREDICTED: transcription factor VOZ1-like [S... 62 1e-07 ref|XP_002331942.1| predicted protein [Populus trichocarpa] gi|5... 62 1e-07 ref|XP_006467712.1| PREDICTED: transcription factor VOZ1-like is... 60 4e-07 ref|XP_006467710.1| PREDICTED: transcription factor VOZ1-like is... 60 4e-07 ref|XP_006449426.1| hypothetical protein CICLE_v10015064mg [Citr... 60 4e-07 ref|XP_006449425.1| hypothetical protein CICLE_v10015064mg [Citr... 60 4e-07 ref|XP_002522505.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_004293908.1| PREDICTED: transcription factor VOZ1-like [F... 58 1e-06 ref|XP_004248126.1| PREDICTED: transcription factor VOZ1-like is... 57 3e-06 ref|XP_004134679.1| PREDICTED: transcription factor VOZ1-like [C... 56 4e-06 gb|ESW25886.1| hypothetical protein PHAVU_003G073700g [Phaseolus... 55 9e-06 gb|ESW25885.1| hypothetical protein PHAVU_003G073700g [Phaseolus... 55 9e-06 gb|AGV54566.1| hypothetical protein [Phaseolus vulgaris] 55 9e-06 >gb|EOY28131.1| Vascular plant one zinc finger protein isoform 1 [Theobroma cacao] gi|508780877|gb|EOY28133.1| Vascular plant one zinc finger protein isoform 1 [Theobroma cacao] Length = 480 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R VK RGK N K G GN Y+ N +A E FDY G YDYLVDN+ GYYLT Sbjct: 423 PSDNKRYVKGRGKINAKVGVGNLYATPNVVAPTSEKFDYGLGVQYDYLVDNLTGYYLT 480 >dbj|BAJ07177.1| MdVOZ1 [Malus domestica] Length = 483 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 37/58 (63%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R VK R K N K GN Y N A+ FDY GAPYDYLVDN+NGYYLT Sbjct: 426 PSDNKRTVKGRAKVNAKVSVGNVYYAPNRGATTNGTFDYEIGAPYDYLVDNVNGYYLT 483 >gb|EMJ15159.1| hypothetical protein PRUPE_ppa004946mg [Prunus persica] gi|462409826|gb|EMJ15160.1| hypothetical protein PRUPE_ppa004946mg [Prunus persica] Length = 484 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R VK R KAN K G GN Y N + FDY GAPYDYLV+N+NGYYLT Sbjct: 427 PSDNKRCVKGRAKANEKVGVGNVYYTPNRGGTTNGTFDYGIGAPYDYLVENVNGYYLT 484 >emb|CBI30629.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P D +R VK R K N+KDG G+ YS N + P + DY G PYDYLV+N+ YYLT Sbjct: 427 PLDNKRSVKGRTKINMKDGVGDVYSTPNRVGPPNQQGDYGVGGPYDYLVENLGDYYLT 484 >ref|XP_002273268.1| PREDICTED: uncharacterized protein LOC100243518 [Vitis vinifera] Length = 485 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P D +R VK R K N+KDG G+ YS N + P + DY G PYDYLV+N+ YYLT Sbjct: 428 PLDNKRSVKGRTKINMKDGVGDVYSTPNRVGPPNQQGDYGVGGPYDYLVENLGDYYLT 485 >ref|XP_002305772.1| hypothetical protein POPTR_0004s05030g [Populus trichocarpa] gi|222848736|gb|EEE86283.1| hypothetical protein POPTR_0004s05030g [Populus trichocarpa] Length = 491 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPY-DYLVDNINGYYLT 175 P D +R VK R K N K G GN YSGS +A E +DY G Y DYLV+N+ GYYLT Sbjct: 428 PPDNKRAVKGRTKVNAKVGVGNVYSGSTQVAPTNEAYDYGPGPHYDDYLVENLEGYYLT 486 >ref|XP_004232932.1| PREDICTED: transcription factor VOZ1-like [Solanum lycopersicum] Length = 467 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/59 (55%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPY-DYLVDNINGYYLT 175 P + +R VK RGKAN KD N N EGFDYV GAP+ DYLVDNI GYY+T Sbjct: 409 PLENKRSVKGRGKANSKDVVTNGPPAPNQTVPAIEGFDYVAGAPFPDYLVDNIGGYYIT 467 >ref|XP_002331942.1| predicted protein [Populus trichocarpa] gi|566193983|ref|XP_006377435.1| hypothetical protein POPTR_0011s05890g [Populus trichocarpa] gi|550327725|gb|ERP55232.1| hypothetical protein POPTR_0011s05890g [Populus trichocarpa] Length = 489 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/58 (50%), Positives = 35/58 (60%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R VK R K N K G N YSG+ A E +DY G YDYLV+N+ YYLT Sbjct: 427 PSDHKRAVKGRTKVNAKAGVRNVYSGATQAAPTNEAYDYGPGPHYDYLVENLGDYYLT 484 >ref|XP_006467712.1| PREDICTED: transcription factor VOZ1-like isoform X3 [Citrus sinensis] Length = 479 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTG-NTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R+VK R K N K G G N Y SN +AS E FDY +DYL++N++ YYLT Sbjct: 421 PSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTNEKFDYGPTGQFDYLIENLSEYYLT 479 >ref|XP_006467710.1| PREDICTED: transcription factor VOZ1-like isoform X1 [Citrus sinensis] gi|568826706|ref|XP_006467711.1| PREDICTED: transcription factor VOZ1-like isoform X2 [Citrus sinensis] Length = 485 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTG-NTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R+VK R K N K G G N Y SN +AS E FDY +DYL++N++ YYLT Sbjct: 427 PSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTNEKFDYGPTGQFDYLIENLSEYYLT 485 >ref|XP_006449426.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] gi|557552037|gb|ESR62666.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] Length = 479 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTG-NTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R+VK R K N K G G N Y SN +AS E FDY +DYL++N++ YYLT Sbjct: 421 PSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTNEKFDYGPTGQFDYLIENLSEYYLT 479 >ref|XP_006449425.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] gi|567914227|ref|XP_006449427.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] gi|567914229|ref|XP_006449428.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] gi|557552036|gb|ESR62665.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] gi|557552038|gb|ESR62667.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] gi|557552039|gb|ESR62668.1| hypothetical protein CICLE_v10015064mg [Citrus clementina] Length = 485 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTG-NTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R+VK R K N K G G N Y SN +AS E FDY +DYL++N++ YYLT Sbjct: 427 PSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTNEKFDYGPTGQFDYLIENLSEYYLT 485 >ref|XP_002522505.1| conserved hypothetical protein [Ricinus communis] gi|223538196|gb|EEF39805.1| conserved hypothetical protein [Ricinus communis] Length = 484 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R VK R K ++K G GN YS +N + E +DY G PY+YLVDN+ YY+T Sbjct: 428 PSDNKRSVKGRTKVSVKVGVGNVYSTTNRVVPTNETYDYELG-PYNYLVDNLGDYYVT 484 >ref|XP_004293908.1| PREDICTED: transcription factor VOZ1-like [Fragaria vesca subsp. vesca] Length = 489 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 6/64 (9%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTY------SGSNALASPGEGFDYVRGAPYDYLVDNING 163 P+D +R VK R K N K G G Y + +N ++ G FDY G PYDY+VDN++G Sbjct: 427 PSDNKRNVKGRAKVNAKVGVGTVYYTPSQGTATNGTSTNGT-FDYGTGPPYDYVVDNLSG 485 Query: 164 YYLT 175 YYLT Sbjct: 486 YYLT 489 >ref|XP_004248126.1| PREDICTED: transcription factor VOZ1-like isoform 1 [Solanum lycopersicum] gi|460405326|ref|XP_004248127.1| PREDICTED: transcription factor VOZ1-like isoform 2 [Solanum lycopersicum] Length = 477 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/58 (46%), Positives = 39/58 (67%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P D +R VK R KAN+K+ GN ++ + GEGFDY PYDYL+D+++GY++T Sbjct: 421 PLDNKRTVKGRVKANMKN-MGNIHAAPVPIVPIGEGFDYGNTDPYDYLLDDLDGYFIT 477 >ref|XP_004134679.1| PREDICTED: transcription factor VOZ1-like [Cucumis sativus] gi|449479263|ref|XP_004155552.1| PREDICTED: transcription factor VOZ1-like [Cucumis sativus] Length = 483 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = +2 Query: 8 DKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 D +R VK R + N K G GN Y N + P +DY+ A YDYLV+N++ YYLT Sbjct: 428 DNKRFVKGRTRINTKVGLGNVYPSGNRVMPPSGTYDYMLHAQYDYLVENLSEYYLT 483 >gb|ESW25886.1| hypothetical protein PHAVU_003G073700g [Phaseolus vulgaris] gi|561027247|gb|ESW25887.1| hypothetical protein PHAVU_003G073700g [Phaseolus vulgaris] Length = 477 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/58 (43%), Positives = 34/58 (58%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R K R K N K G G YS S+ + + ++Y APYDYLV+N+ YY T Sbjct: 420 PHDNKRAAKGRAKVNAKVGIGGVYSASHRVTTLNGAYEYGLAAPYDYLVENMGDYYGT 477 >gb|ESW25885.1| hypothetical protein PHAVU_003G073700g [Phaseolus vulgaris] Length = 518 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/58 (43%), Positives = 34/58 (58%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R K R K N K G G YS S+ + + ++Y APYDYLV+N+ YY T Sbjct: 461 PHDNKRAAKGRAKVNAKVGIGGVYSASHRVTTLNGAYEYGLAAPYDYLVENMGDYYGT 518 >gb|AGV54566.1| hypothetical protein [Phaseolus vulgaris] Length = 392 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/58 (43%), Positives = 34/58 (58%) Frame = +2 Query: 2 PNDKQRVVKVRGKANLKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 175 P+D +R K R K N K G G YS S+ + + ++Y APYDYLV+N+ YY T Sbjct: 335 PHDNKRAAKGRAKVNAKVGIGGVYSASHRVTTLNGAYEYGLAAPYDYLVENMGDYYGT 392