BLASTX nr result
ID: Rehmannia22_contig00011647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00011647 (968 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299588.1| hypothetical protein POPTR_0001s16850g [Popu... 63 1e-07 ref|XP_006426659.1| hypothetical protein CICLE_v10026763mg [Citr... 62 4e-07 gb|EXB23812.1| hypothetical protein L484_009573 [Morus notabilis] 60 1e-06 ref|XP_006583160.1| PREDICTED: uncharacterized protein LOC102662... 60 1e-06 ref|XP_002304133.1| predicted protein [Populus trichocarpa] 60 2e-06 ref|XP_002521323.1| conserved hypothetical protein [Ricinus comm... 59 4e-06 ref|XP_006385515.1| hypothetical protein POPTR_0003s06410g [Popu... 58 6e-06 gb|EOY27253.1| Uncharacterized protein TCM_029139 [Theobroma cacao] 58 6e-06 ref|XP_002339178.1| predicted protein [Populus trichocarpa] 58 6e-06 gb|ESW07429.1| hypothetical protein PHAVU_010G129200g [Phaseolus... 57 8e-06 >ref|XP_002299588.1| hypothetical protein POPTR_0001s16850g [Populus trichocarpa] gi|222846846|gb|EEE84393.1| hypothetical protein POPTR_0001s16850g [Populus trichocarpa] Length = 127 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = +1 Query: 325 VQRGTANNFQSYPVDNYSGGLEFRIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 V RG A +F P ++ RIGSSSWGLAG+L+ML+ V+SWQ SVQ FFWR Sbjct: 77 VHRGAAASFIPSPDPSWV----LRIGSSSWGLAGVLVMLVLVLSWQDSVQEFFWR 127 >ref|XP_006426659.1| hypothetical protein CICLE_v10026763mg [Citrus clementina] gi|557528649|gb|ESR39899.1| hypothetical protein CICLE_v10026763mg [Citrus clementina] Length = 130 Score = 61.6 bits (148), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIG SSWGLAGIL+ML+ V+SWQ SVQHFFWR Sbjct: 99 RIGGSSWGLAGILVMLMLVLSWQDSVQHFFWR 130 >gb|EXB23812.1| hypothetical protein L484_009573 [Morus notabilis] Length = 124 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIGSSSWGLAG+L+MLI V+SWQ SVQ FFWR Sbjct: 93 RIGSSSWGLAGVLLMLILVLSWQDSVQEFFWR 124 >ref|XP_006583160.1| PREDICTED: uncharacterized protein LOC102662761 [Glycine max] Length = 122 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIGSSSWGLAGIL+ML+ V+ WQASVQ FFWR Sbjct: 91 RIGSSSWGLAGILVMLMLVLYWQASVQEFFWR 122 >ref|XP_002304133.1| predicted protein [Populus trichocarpa] Length = 128 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIGSSSWGLAG+L+ML+ V+SWQ SVQ FFWR Sbjct: 97 RIGSSSWGLAGVLVMLMLVLSWQDSVQEFFWR 128 >ref|XP_002521323.1| conserved hypothetical protein [Ricinus communis] gi|223539401|gb|EEF40991.1| conserved hypothetical protein [Ricinus communis] Length = 123 Score = 58.5 bits (140), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIGSSSWGLAGI++ML+ V+SWQ SVQ FFW+ Sbjct: 92 RIGSSSWGLAGIIVMLMLVLSWQESVQEFFWK 123 >ref|XP_006385515.1| hypothetical protein POPTR_0003s06410g [Populus trichocarpa] gi|550342547|gb|ERP63312.1| hypothetical protein POPTR_0003s06410g [Populus trichocarpa] Length = 128 Score = 57.8 bits (138), Expect = 6e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIGSS WGLAG+L+ML+ V+SWQ SVQ FFWR Sbjct: 97 RIGSSPWGLAGVLVMLMLVLSWQDSVQEFFWR 128 >gb|EOY27253.1| Uncharacterized protein TCM_029139 [Theobroma cacao] Length = 123 Score = 57.8 bits (138), Expect = 6e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIG SSWGLAGIL++L+ V+SWQ SVQ FFWR Sbjct: 92 RIGGSSWGLAGILVLLMLVLSWQESVQEFFWR 123 >ref|XP_002339178.1| predicted protein [Populus trichocarpa] Length = 128 Score = 57.8 bits (138), Expect = 6e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 RIGSS WGLAG+L+ML+ V+SWQ SVQ FFWR Sbjct: 97 RIGSSPWGLAGVLVMLMLVLSWQDSVQEFFWR 128 >gb|ESW07429.1| hypothetical protein PHAVU_010G129200g [Phaseolus vulgaris] Length = 126 Score = 57.4 bits (137), Expect = 8e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 394 RIGSSSWGLAGILIMLIFVISWQASVQHFFWR 489 R+GSSSWGL GIL+ML+ V+ WQASVQ FFW+ Sbjct: 95 RVGSSSWGLGGILVMLMLVLHWQASVQEFFWK 126