BLASTX nr result
ID: Rehmannia22_contig00011474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00011474 (627 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70232.1| hypothetical protein M569_04529, partial [Genlise... 46 2e-08 >gb|EPS70232.1| hypothetical protein M569_04529, partial [Genlisea aurea] Length = 289 Score = 46.2 bits (108), Expect(2) = 2e-08 Identities = 37/99 (37%), Positives = 53/99 (53%), Gaps = 21/99 (21%) Frame = +3 Query: 252 EPSKEVDKELGDYNTNSCRKKLDFDS-------------------ESKPNLEPKNLLVY- 371 + KEV++ G + +SCR+ L F S +S+P+ E VY Sbjct: 78 DDEKEVNQ--GFFVEHSCRRALVFSSSDDISLDQKSSDILLDSVAQSQPHDESSCFRVYQ 135 Query: 372 RRRIFKCLKNSRKLGPNW-TLFKKARMIRQRATEFAKFI 485 RRR CL N+RKLG N+ + K++RM R++AT FAKFI Sbjct: 136 RRRKDDCLWNNRKLGLNFPKMCKRSRMKRRKATAFAKFI 174 Score = 38.5 bits (88), Expect(2) = 2e-08 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 17/70 (24%) Frame = +1 Query: 40 ETVEAKSSNEPKIRTPKKRVPVKRLRMKRHRPKVYDEMKAVK-----------------P 168 E K+S + K + P R++MKRHRPKV+DE K + P Sbjct: 2 EMASGKASGKGKTKKP-------RMKMKRHRPKVFDETKPRRKPTTCKVKIQKNNAKHSP 54 Query: 169 LTPKPQTPKR 198 TP +TPKR Sbjct: 55 TTPSSRTPKR 64