BLASTX nr result
ID: Rehmannia22_contig00011254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00011254 (1375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 42 2e-07 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 41.6 bits (96), Expect(2) = 2e-07 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = -2 Query: 1245 INRYMIHLQVVDESASATLL*WDRECEQMIGKSCIDLRQEFVE 1117 I RY + ++ VD +A + WD+EC +++G S DLRQ+ +E Sbjct: 342 ILRYRVKVRAVDLDGNAPFILWDKECTELLGISATDLRQKILE 384 Score = 41.6 bits (96), Expect(2) = 2e-07 Identities = 16/49 (32%), Positives = 32/49 (65%) Frame = -3 Query: 998 PVELPADLKALIGKMVLFKVQIKEEQLRNYAGVFSVVKLTTDQNLVWKY 852 P+ +P ++++L+G +LF++ +++EQ N F+V+K+ D LV Y Sbjct: 386 PLRIPREIESLVGLAMLFRIAVRKEQFDNLHNAFAVMKVMNDPKLVSVY 434