BLASTX nr result
ID: Rehmannia22_contig00011118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00011118 (695 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62316.1| hypothetical protein VITISV_018210 [Vitis vinifera] 77 7e-12 gb|EXC73207.1| Serine/threonine-protein kinase [Morus notabilis] 75 2e-11 gb|EXB66240.1| Serine/threonine-protein kinase [Morus notabilis] 75 2e-11 ref|XP_006588824.1| PREDICTED: serine/threonine-protein kinase C... 75 2e-11 ref|XP_006481892.1| PREDICTED: serine/threonine-protein kinase C... 75 2e-11 ref|XP_006341169.1| PREDICTED: serine/threonine-protein kinase C... 75 2e-11 ref|XP_006338940.1| PREDICTED: serine/threonine-protein kinase C... 75 2e-11 gb|ESW17250.1| hypothetical protein PHAVU_007G223500g [Phaseolus... 75 2e-11 ref|XP_006430301.1| hypothetical protein CICLE_v10013782mg [Citr... 75 2e-11 gb|EOY08118.1| Map3k delta-1 protein kinase, putative isoform 2 ... 75 2e-11 gb|EOY08117.1| Map3k delta-1 protein kinase, putative isoform 1 ... 75 2e-11 ref|XP_004497601.1| PREDICTED: serine/threonine-protein kinase C... 75 2e-11 gb|AEX07321.2| serine/threonine protein kinase [Carica papaya] 75 2e-11 gb|EMJ04722.1| hypothetical protein PRUPE_ppa001532mg [Prunus pe... 75 2e-11 gb|AAY21209.1| serine/threonine protein kinase [Prunus persica] 75 2e-11 ref|XP_004303028.1| PREDICTED: serine/threonine-protein kinase C... 75 2e-11 gb|ACZ66010.1| serine/threonine protein kinase 1 [Gossypium hirs... 75 2e-11 gb|ADW95823.1| serine/threonine-specific protein kinase CTR1 [Ol... 75 2e-11 gb|ADE75969.1| unknown [Picea sitchensis] 75 2e-11 gb|ACR23642.1| serine/threonine protein kinase [Prunus persica] 75 2e-11 >emb|CAN62316.1| hypothetical protein VITISV_018210 [Vitis vinifera] Length = 317 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/51 (72%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -2 Query: 151 YSVCLYILTF-NVFNQVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 Y+V ++L++ ++VCDFGLSR KANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 101 YTVKKFVLSYVGNLHEVCDFGLSRFKANTFLSSKSAAGTPEWMAPEVLRDE 151 >gb|EXC73207.1| Serine/threonine-protein kinase [Morus notabilis] Length = 164 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 30 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 65 >gb|EXB66240.1| Serine/threonine-protein kinase [Morus notabilis] Length = 861 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 727 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 762 >ref|XP_006588824.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Glycine max] Length = 836 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 702 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 737 >ref|XP_006481892.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Citrus sinensis] Length = 868 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 734 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 769 >ref|XP_006341169.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Solanum tuberosum] Length = 835 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 699 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 734 >ref|XP_006338940.1| PREDICTED: serine/threonine-protein kinase CTR1-like isoform X1 [Solanum tuberosum] gi|565343648|ref|XP_006338941.1| PREDICTED: serine/threonine-protein kinase CTR1-like isoform X2 [Solanum tuberosum] gi|565343650|ref|XP_006338942.1| PREDICTED: serine/threonine-protein kinase CTR1-like isoform X3 [Solanum tuberosum] Length = 792 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 674 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 709 >gb|ESW17250.1| hypothetical protein PHAVU_007G223500g [Phaseolus vulgaris] Length = 836 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 702 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 737 >ref|XP_006430301.1| hypothetical protein CICLE_v10013782mg [Citrus clementina] gi|557532358|gb|ESR43541.1| hypothetical protein CICLE_v10013782mg [Citrus clementina] Length = 868 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 734 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 769 >gb|EOY08118.1| Map3k delta-1 protein kinase, putative isoform 2 [Theobroma cacao] Length = 797 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 728 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 763 >gb|EOY08117.1| Map3k delta-1 protein kinase, putative isoform 1 [Theobroma cacao] Length = 862 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 728 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 763 >ref|XP_004497601.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Cicer arietinum] Length = 847 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 713 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 748 >gb|AEX07321.2| serine/threonine protein kinase [Carica papaya] Length = 718 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 584 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 619 >gb|EMJ04722.1| hypothetical protein PRUPE_ppa001532mg [Prunus persica] Length = 806 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 707 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 742 >gb|AAY21209.1| serine/threonine protein kinase [Prunus persica] Length = 206 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 121 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 156 >ref|XP_004303028.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Fragaria vesca subsp. vesca] gi|384979221|gb|AFI38955.1| CTR1 [Fragaria x ananassa] Length = 845 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 711 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 746 >gb|ACZ66010.1| serine/threonine protein kinase 1 [Gossypium hirsutum] gi|357372870|gb|AET74054.1| constitutive triple response 1 [Gossypium hirsutum] Length = 851 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 717 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 752 >gb|ADW95823.1| serine/threonine-specific protein kinase CTR1 [Olea europaea] Length = 326 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 220 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 255 >gb|ADE75969.1| unknown [Picea sitchensis] Length = 319 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 185 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 220 >gb|ACR23642.1| serine/threonine protein kinase [Prunus persica] Length = 843 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 109 QVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 2 +VCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE Sbjct: 709 KVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDE 744