BLASTX nr result
ID: Rehmannia22_contig00010574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00010574 (478 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309375.2| hypothetical protein POPTR_0006s19250g [Popu... 84 1e-14 gb|AHB08880.1| HD domain-containing protein [Suaeda glauca] 83 3e-14 gb|EPS64938.1| hypothetical protein M569_09841, partial [Genlise... 83 3e-14 ref|XP_006404869.1| hypothetical protein EUTSA_v10000291mg [Eutr... 83 4e-14 ref|XP_004309776.1| PREDICTED: HD domain-containing protein 2-li... 82 7e-14 ref|XP_006845465.1| hypothetical protein AMTR_s00019p00129010 [A... 80 3e-13 ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-li... 80 4e-13 gb|EMJ24957.1| hypothetical protein PRUPE_ppa010557mg [Prunus pe... 80 4e-13 ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2-li... 80 4e-13 ref|XP_006294862.1| hypothetical protein CARUB_v10023915mg [Caps... 79 5e-13 ref|XP_006453513.1| hypothetical protein CICLE_v10009257mg [Citr... 79 6e-13 gb|EXB94889.1| HD domain-containing protein 2 [Morus notabilis] 79 8e-13 ref|XP_002878700.1| metal-dependent phosphohydrolase HD domain-c... 79 8e-13 ref|NP_973522.1| Metal-dependent phosphohydrolase [Arabidopsis t... 78 1e-12 dbj|BAE99246.1| hypothetical protein [Arabidopsis thaliana] 78 1e-12 ref|NP_001148228.1| LOC100281836 precursor [Zea mays] gi|1956168... 78 1e-12 ref|XP_004951699.1| PREDICTED: HD domain-containing protein 2-li... 77 2e-12 ref|XP_002272377.2| PREDICTED: HD domain-containing protein 2 ho... 77 3e-12 ref|XP_003570627.1| PREDICTED: HD domain-containing protein 2-li... 77 3e-12 ref|XP_002272441.1| PREDICTED: HD domain-containing protein 2 ho... 77 3e-12 >ref|XP_002309375.2| hypothetical protein POPTR_0006s19250g [Populus trichocarpa] gi|550336643|gb|EEE92898.2| hypothetical protein POPTR_0006s19250g [Populus trichocarpa] Length = 248 Score = 84.3 bits (207), Expect = 1e-14 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYENEQGKDLEEFF+STAGKFQT++GKAWALEIASRRRK+ Sbjct: 205 QALEYENEQGKDLEEFFQSTAGKFQTEVGKAWALEIASRRRKE 247 >gb|AHB08880.1| HD domain-containing protein [Suaeda glauca] Length = 208 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 353 QALEYE EQGKDLEEFFESTAGKFQTD+GKAWALEIASRR+K Sbjct: 166 QALEYEKEQGKDLEEFFESTAGKFQTDIGKAWALEIASRRKK 207 >gb|EPS64938.1| hypothetical protein M569_09841, partial [Genlisea aurea] Length = 201 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 353 QALEYENEQGKDLEEFFESTAGKFQT++GK+WALE+ASRRRK Sbjct: 160 QALEYENEQGKDLEEFFESTAGKFQTEVGKSWALEVASRRRK 201 >ref|XP_006404869.1| hypothetical protein EUTSA_v10000291mg [Eutrema salsugineum] gi|557105997|gb|ESQ46322.1| hypothetical protein EUTSA_v10000291mg [Eutrema salsugineum] Length = 264 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYE +QGKDLEEFF+STAGKFQTD+GKAWALEIASRR+KQ Sbjct: 221 QALEYEQDQGKDLEEFFQSTAGKFQTDIGKAWALEIASRRKKQ 263 >ref|XP_004309776.1| PREDICTED: HD domain-containing protein 2-like [Fragaria vesca subsp. vesca] Length = 207 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYEN+QGKDLEEFF+STAGKFQTD GKAWA EIASRR+KQ Sbjct: 164 QALEYENDQGKDLEEFFQSTAGKFQTDAGKAWAAEIASRRKKQ 206 >ref|XP_006845465.1| hypothetical protein AMTR_s00019p00129010 [Amborella trichopoda] gi|548848037|gb|ERN07140.1| hypothetical protein AMTR_s00019p00129010 [Amborella trichopoda] Length = 212 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 353 QALEYENEQGKDL EFFESTAGKFQTD+GKAWA EIASRR++ Sbjct: 166 QALEYENEQGKDLNEFFESTAGKFQTDVGKAWAAEIASRRKR 207 >ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-like [Solanum tuberosum] Length = 241 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 353 QALEYENEQGKDLEEFF+STAGKFQT++GKAWA E+ASRR+K Sbjct: 198 QALEYENEQGKDLEEFFQSTAGKFQTEVGKAWASEVASRRKK 239 >gb|EMJ24957.1| hypothetical protein PRUPE_ppa010557mg [Prunus persica] Length = 245 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYE +QGKDLEEFF+STAGKFQTDLGK+WA E+ASRR+KQ Sbjct: 202 QALEYEKDQGKDLEEFFQSTAGKFQTDLGKSWASEVASRRKKQ 244 >ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2-like [Solanum lycopersicum] Length = 242 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 353 QALEYENEQGKDLEEFF+STAGKFQT++GKAWA E+ASRR+K Sbjct: 199 QALEYENEQGKDLEEFFQSTAGKFQTEVGKAWASEVASRRKK 240 >ref|XP_006294862.1| hypothetical protein CARUB_v10023915mg [Capsella rubella] gi|482563570|gb|EOA27760.1| hypothetical protein CARUB_v10023915mg [Capsella rubella] Length = 250 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYE QGKDLEEFF+STAGKFQTD+GKAWA EI SRRRKQ Sbjct: 207 QALEYEQAQGKDLEEFFQSTAGKFQTDIGKAWAAEIVSRRRKQ 249 >ref|XP_006453513.1| hypothetical protein CICLE_v10009257mg [Citrus clementina] gi|568840247|ref|XP_006474081.1| PREDICTED: HD domain-containing protein 2-like [Citrus sinensis] gi|557556739|gb|ESR66753.1| hypothetical protein CICLE_v10009257mg [Citrus clementina] Length = 256 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 353 QA+EYENEQGKDLEEFF+STAGKFQT+LGKAWA EI SRR+K Sbjct: 215 QAVEYENEQGKDLEEFFQSTAGKFQTELGKAWAAEIVSRRKK 256 >gb|EXB94889.1| HD domain-containing protein 2 [Morus notabilis] Length = 262 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYE+EQGKDL+EFF+STAGKFQT+LGKAWA EIASRR+K+ Sbjct: 219 QALEYESEQGKDLDEFFQSTAGKFQTELGKAWASEIASRRQKE 261 >ref|XP_002878700.1| metal-dependent phosphohydrolase HD domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324539|gb|EFH54959.1| metal-dependent phosphohydrolase HD domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 257 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYE QGKDLEEFF+STAGKFQTD+GKAWA EI SRRRKQ Sbjct: 214 QALEYEQGQGKDLEEFFQSTAGKFQTDIGKAWASEIVSRRRKQ 256 >ref|NP_973522.1| Metal-dependent phosphohydrolase [Arabidopsis thaliana] gi|50253436|gb|AAT71920.1| At2g23820 [Arabidopsis thaliana] gi|58331781|gb|AAW70388.1| At2g23820 [Arabidopsis thaliana] gi|330252401|gb|AEC07495.1| Metal-dependent phosphohydrolase [Arabidopsis thaliana] Length = 257 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYE +QGKDLEEFF+STAGKFQT++GKAWA EI SRRRKQ Sbjct: 214 QALEYEQDQGKDLEEFFQSTAGKFQTNIGKAWASEIVSRRRKQ 256 >dbj|BAE99246.1| hypothetical protein [Arabidopsis thaliana] Length = 254 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYE +QGKDLEEFF+STAGKFQT++GKAWA EI SRRRKQ Sbjct: 211 QALEYEQDQGKDLEEFFQSTAGKFQTNIGKAWASEIVSRRRKQ 253 >ref|NP_001148228.1| LOC100281836 precursor [Zea mays] gi|195616818|gb|ACG30239.1| HDDC2 protein [Zea mays] gi|223943231|gb|ACN25699.1| unknown [Zea mays] gi|413935853|gb|AFW70404.1| HDDC2 protein [Zea mays] Length = 246 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRR 356 QALEYE EQG+DLEEFF+STAGKFQTDLGKAWA EIASRR+ Sbjct: 204 QALEYEKEQGRDLEEFFQSTAGKFQTDLGKAWAAEIASRRK 244 >ref|XP_004951699.1| PREDICTED: HD domain-containing protein 2-like [Setaria italica] Length = 250 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRR 356 QALEYE EQG+DLEEFF+STAGKFQTD+GKAWA EIASRR+ Sbjct: 208 QALEYEKEQGRDLEEFFQSTAGKFQTDIGKAWAAEIASRRK 248 >ref|XP_002272377.2| PREDICTED: HD domain-containing protein 2 homolog isoform 1 [Vitis vinifera] Length = 235 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYENEQGKDL+EFF STAGKFQT++GKAWA EIASRR+++ Sbjct: 193 QALEYENEQGKDLDEFFTSTAGKFQTEVGKAWASEIASRRKER 235 >ref|XP_003570627.1| PREDICTED: HD domain-containing protein 2-like [Brachypodium distachyon] Length = 243 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRR 356 QALEYE EQG+DLEEFF+STAGKFQTD+GKAWA EIASRR+ Sbjct: 203 QALEYEKEQGRDLEEFFQSTAGKFQTDVGKAWAAEIASRRK 243 >ref|XP_002272441.1| PREDICTED: HD domain-containing protein 2 homolog isoform 2 [Vitis vinifera] Length = 159 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -1 Query: 478 QALEYENEQGKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 350 QALEYENEQGKDL+EFF STAGKFQT++GKAWA EIASRR+++ Sbjct: 117 QALEYENEQGKDLDEFFTSTAGKFQTEVGKAWASEIASRRKER 159