BLASTX nr result
ID: Rehmannia22_contig00010246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00010246 (721 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus... 58 3e-06 ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659... 57 5e-06 gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus... 57 6e-06 ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 57 6e-06 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 58.9 bits (141), Expect = 2e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = -3 Query: 617 RGQKFRSWRKCTRYIQEQRTRFYIVWRCSIILIRW 513 R KFRSW++C+R ++EQRTR YI+WRC++IL+ W Sbjct: 10 RFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSW 44 >gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 57.8 bits (138), Expect = 3e-06 Identities = 19/37 (51%), Positives = 30/37 (81%) Frame = -3 Query: 623 STRGQKFRSWRKCTRYIQEQRTRFYIVWRCSIILIRW 513 S RG K RSW +C++ +++QRTR YI+WRC+++L+ W Sbjct: 7 SVRGSKIRSWERCSKQVRQQRTRLYIIWRCTVLLLCW 43 >ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659834 [Glycine max] Length = 45 Score = 57.4 bits (137), Expect = 5e-06 Identities = 19/37 (51%), Positives = 30/37 (81%) Frame = -3 Query: 623 STRGQKFRSWRKCTRYIQEQRTRFYIVWRCSIILIRW 513 S RG K RSW +C++ +++QRTR YI+WRC+++L+ W Sbjct: 7 SVRGSKVRSWERCSKQVRQQRTRLYIIWRCTVLLLCW 43 >gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] Length = 70 Score = 57.0 bits (136), Expect = 6e-06 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = -3 Query: 665 NFLKPKIQSFFFMGSTRGQKFRSWRKCTRYIQEQRTRFYIVWRCSIILIRW 513 NF + S R K R W +C++YI++QRTR YI+WRC+++L+ W Sbjct: 18 NFTMTTATTTAMFSSLRASKLRPWGRCSKYIRQQRTRLYIIWRCTVLLLCW 68 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gi|222861166|gb|EEE98708.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 57.0 bits (136), Expect = 6e-06 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = -3 Query: 650 KIQSFFFMGSTRGQKFRSWRKCTRYIQEQRTRFYIVWRCSIILIRW 513 KIQ S R K RSW++C++ I+EQRTR YI+WRC+++L+ W Sbjct: 17 KIQMAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCW 62