BLASTX nr result
ID: Rehmannia22_contig00009998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00009998 (611 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] 42 8e-07 >emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] Length = 115 Score = 41.6 bits (96), Expect(2) = 8e-07 Identities = 25/65 (38%), Positives = 33/65 (50%) Frame = -1 Query: 560 MGMEEMMKFVIDKLKEALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPET 381 MG E +MKFV++KLKE L + LEN GG + DKVF P++ Sbjct: 1 MGAESVMKFVVEKLKELL--------------------VLLENFGGYLVDEVDKVFAPDS 40 Query: 380 RAEKI 366 R EK+ Sbjct: 41 RGEKL 45 Score = 37.7 bits (86), Expect(2) = 8e-07 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -3 Query: 273 VKMMKAPGRNIMIPRSLFASDPKAYFANLR 184 VKMMKAPGR+ + R F S+P+ YF LR Sbjct: 79 VKMMKAPGRDYRMARPPFESNPRGYFRGLR 108