BLASTX nr result
ID: Rehmannia22_contig00009538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00009538 (662 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006429728.1| hypothetical protein CICLE_v10013100mg [Citr... 65 1e-08 dbj|BAG49074.1| 30S ribosomal protein S16 [Populus alba] 64 3e-08 ref|XP_004172096.1| PREDICTED: 30S ribosomal protein S16-like [C... 64 5e-08 ref|XP_006281308.1| hypothetical protein CARUB_v10027361mg [Caps... 63 7e-08 ref|XP_002331484.1| predicted protein [Populus trichocarpa] gi|5... 63 7e-08 ref|XP_002281553.1| PREDICTED: 30S ribosomal protein S16 [Vitis ... 63 7e-08 gb|EOY30420.1| Ribosomal protein S16 family protein [Theobroma c... 63 9e-08 gb|EMJ03913.1| hypothetical protein PRUPE_ppa012786mg [Prunus pe... 63 9e-08 gb|EMJ03912.1| hypothetical protein PRUPE_ppa012786mg [Prunus pe... 63 9e-08 gb|EPS61558.1| hypothetical protein M569_13239, partial [Genlise... 62 2e-07 ref|NP_001238227.1| uncharacterized protein LOC100305630 [Glycin... 62 2e-07 ref|XP_006362458.1| PREDICTED: 28S ribosomal protein S16, mitoch... 61 3e-07 ref|XP_006401264.1| hypothetical protein EUTSA_v10014987mg [Eutr... 61 3e-07 ref|NP_001234444.1| 30S ribosomal protein S16 [Solanum lycopersi... 61 3e-07 gb|EXB38861.1| 28S ribosomal protein S16 [Morus notabilis] 60 4e-07 ref|NP_001236904.1| uncharacterized protein LOC100499851 [Glycin... 60 4e-07 ref|NP_200504.1| ribosomal protein S16 family protein [Arabidops... 60 6e-07 ref|XP_002863022.1| ribosomal protein S16 family protein [Arabid... 60 6e-07 gb|AAM63199.1| 30S ribosomal protein S16 [Arabidopsis thaliana] 60 6e-07 gb|EXB38862.1| 37S ribosomal protein S16 [Morus notabilis] 59 1e-06 >ref|XP_006429728.1| hypothetical protein CICLE_v10013100mg [Citrus clementina] gi|567874279|ref|XP_006429729.1| hypothetical protein CICLE_v10013100mg [Citrus clementina] gi|568855461|ref|XP_006481323.1| PREDICTED: 28S ribosomal protein S16, mitochondrial-like isoform X1 [Citrus sinensis] gi|568855463|ref|XP_006481324.1| PREDICTED: 28S ribosomal protein S16, mitochondrial-like isoform X2 [Citrus sinensis] gi|557531785|gb|ESR42968.1| hypothetical protein CICLE_v10013100mg [Citrus clementina] gi|557531786|gb|ESR42969.1| hypothetical protein CICLE_v10013100mg [Citrus clementina] Length = 131 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVM 571 LLPPPPM+AMGRKGGPRDTRPVDPMTGRV+ Sbjct: 82 LLPPPPMVAMGRKGGPRDTRPVDPMTGRVL 111 >dbj|BAG49074.1| 30S ribosomal protein S16 [Populus alba] Length = 136 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQDSA 547 LLPPPPM+ MGRKGGPRDTRPVDPMTGR ++ K S+ Sbjct: 82 LLPPPPMMVMGRKGGPRDTRPVDPMTGRFLSPEKSPSS 119 >ref|XP_004172096.1| PREDICTED: 30S ribosomal protein S16-like [Cucumis sativus] Length = 127 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQ 556 LLPPPPM+AMGRKGGPRDTRPVDP++GR +T K+ Sbjct: 82 LLPPPPMVAMGRKGGPRDTRPVDPLSGRFVTPAKK 116 >ref|XP_006281308.1| hypothetical protein CARUB_v10027361mg [Capsella rubella] gi|482550012|gb|EOA14206.1| hypothetical protein CARUB_v10027361mg [Capsella rubella] Length = 131 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQ 556 LLPPPPMLAMGRKGGPRD RPVDPMTGR + K+ Sbjct: 82 LLPPPPMLAMGRKGGPRDNRPVDPMTGRYVDAEKK 116 >ref|XP_002331484.1| predicted protein [Populus trichocarpa] gi|566168089|ref|XP_006384971.1| ribosomal protein S16 [Populus trichocarpa] gi|550341739|gb|ERP62768.1| ribosomal protein S16 [Populus trichocarpa] Length = 136 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQDSA 547 +LPPPPM+ MGRKGGPRDTRPVDPMTGR ++ K S+ Sbjct: 82 VLPPPPMMVMGRKGGPRDTRPVDPMTGRFLSPEKSPSS 119 >ref|XP_002281553.1| PREDICTED: 30S ribosomal protein S16 [Vitis vinifera] gi|297738652|emb|CBI27897.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGK 559 LLPPPPM+AMGRKGG RDTRPVDP+TGR++T K Sbjct: 82 LLPPPPMVAMGRKGGHRDTRPVDPLTGRILTPNK 115 >gb|EOY30420.1| Ribosomal protein S16 family protein [Theobroma cacao] Length = 136 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQDSA 547 LLPPPPM+AMGRKGGPRD RPVDPM GRV++ K +A Sbjct: 82 LLPPPPMVAMGRKGGPRDMRPVDPMRGRVLSAEKPATA 119 >gb|EMJ03913.1| hypothetical protein PRUPE_ppa012786mg [Prunus persica] Length = 132 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMT 568 LLPPPPM+AMGRKGGPRDTRPVDP++GR+++ Sbjct: 82 LLPPPPMVAMGRKGGPRDTRPVDPLSGRILS 112 >gb|EMJ03912.1| hypothetical protein PRUPE_ppa012786mg [Prunus persica] Length = 154 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMT 568 LLPPPPM+AMGRKGGPRDTRPVDP++GR+++ Sbjct: 82 LLPPPPMVAMGRKGGPRDTRPVDPLSGRILS 112 >gb|EPS61558.1| hypothetical protein M569_13239, partial [Genlisea aurea] Length = 110 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRV 574 LLPPPPM+AMGRKGGPRDTRPV PMTGRV Sbjct: 82 LLPPPPMVAMGRKGGPRDTRPVHPMTGRV 110 >ref|NP_001238227.1| uncharacterized protein LOC100305630 [Glycine max] gi|255626139|gb|ACU13414.1| unknown [Glycine max] Length = 132 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQDSA 547 +LPPPPM+AMGRKGGPRDTRPVD +TGRV+ K +A Sbjct: 82 MLPPPPMVAMGRKGGPRDTRPVDALTGRVLNQEKAANA 119 >ref|XP_006362458.1| PREDICTED: 28S ribosomal protein S16, mitochondrial-like [Solanum tuberosum] Length = 132 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQDSA 547 +LPPPPMLAMG+KGGPRDTR VDPMTGR+ T SA Sbjct: 82 VLPPPPMLAMGQKGGPRDTRLVDPMTGRITTPESAKSA 119 >ref|XP_006401264.1| hypothetical protein EUTSA_v10014987mg [Eutrema salsugineum] gi|557102354|gb|ESQ42717.1| hypothetical protein EUTSA_v10014987mg [Eutrema salsugineum] Length = 135 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQ 556 LLPPPPM+AMGRKGG RDTRPVDPMTGR + K+ Sbjct: 82 LLPPPPMVAMGRKGGARDTRPVDPMTGRYVDAEKK 116 >ref|NP_001234444.1| 30S ribosomal protein S16 [Solanum lycopersicum] gi|190609945|dbj|BAG49073.1| 30S ribosomal protein S16 [Solanum lycopersicum] Length = 132 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMTLGKQDSA 547 +LPPPPMLAMG+KGGPRDTR VDPMTGR+ T SA Sbjct: 82 VLPPPPMLAMGQKGGPRDTRLVDPMTGRITTPESTKSA 119 >gb|EXB38861.1| 28S ribosomal protein S16 [Morus notabilis] Length = 128 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMT 568 LLPPPPM+AMGRKGG RDTRPVDP++GR++T Sbjct: 82 LLPPPPMVAMGRKGGLRDTRPVDPLSGRILT 112 >ref|NP_001236904.1| uncharacterized protein LOC100499851 [Glycine max] gi|255627125|gb|ACU13907.1| unknown [Glycine max] Length = 132 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVM 571 +LPPPPM+AMGRKGGPRDTRPVD +TGRV+ Sbjct: 82 MLPPPPMVAMGRKGGPRDTRPVDALTGRVL 111 >ref|NP_200504.1| ribosomal protein S16 family protein [Arabidopsis thaliana] gi|8777434|dbj|BAA97024.1| 30S ribosomal protein S16 [Arabidopsis thaliana] gi|14334472|gb|AAK59434.1| putative 30S ribosomal protein S16 [Arabidopsis thaliana] gi|16323518|gb|AAL15253.1| putative 30S ribosomal protein S16 [Arabidopsis thaliana] gi|332009442|gb|AED96825.1| ribosomal protein S16 family protein [Arabidopsis thaliana] Length = 135 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGR 577 LLPPPPM+AMGRKGG RDTRPVDPMTGR Sbjct: 82 LLPPPPMVAMGRKGGARDTRPVDPMTGR 109 >ref|XP_002863022.1| ribosomal protein S16 family protein [Arabidopsis lyrata subsp. lyrata] gi|297793207|ref|XP_002864488.1| ribosomal protein S16 family protein [Arabidopsis lyrata subsp. lyrata] gi|297308822|gb|EFH39281.1| ribosomal protein S16 family protein [Arabidopsis lyrata subsp. lyrata] gi|297310323|gb|EFH40747.1| ribosomal protein S16 family protein [Arabidopsis lyrata subsp. lyrata] Length = 135 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGR 577 LLPPPPM+AMGRKGG RDTRPVDPMTGR Sbjct: 82 LLPPPPMVAMGRKGGARDTRPVDPMTGR 109 >gb|AAM63199.1| 30S ribosomal protein S16 [Arabidopsis thaliana] Length = 135 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGR 577 LLPPPPM+AMGRKGG RDTRPVDPMTGR Sbjct: 82 LLPPPPMVAMGRKGGARDTRPVDPMTGR 109 >gb|EXB38862.1| 37S ribosomal protein S16 [Morus notabilis] Length = 276 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 660 LLPPPPMLAMGRKGGPRDTRPVDPMTGRVMT 568 LLPPPPM+AMGRKGG RDTRPVDP+ GR++T Sbjct: 73 LLPPPPMVAMGRKGGLRDTRPVDPLYGRILT 103