BLASTX nr result
ID: Rehmannia22_contig00009422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00009422 (327 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHI48503.1| multidrug and toxic extrusion transporter [Vaccin... 56 6e-06 >gb|AHI48503.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum] Length = 518 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = +1 Query: 1 WIVYRTDWNKEASIAAQRIRQW--KGEIDVKPNDAEK 105 WI+YRT+WNKEASIA RIRQW +GE D K ND EK Sbjct: 482 WIIYRTNWNKEASIAGNRIRQWGGEGEPDDKANDIEK 518