BLASTX nr result
ID: Rehmannia22_contig00009182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00009182 (419 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65250.1| hypothetical protein M569_09526, partial [Genlise... 59 9e-07 gb|EOY17212.1| 50S ribosomal protein L21 isoform 2 [Theobroma ca... 58 1e-06 >gb|EPS65250.1| hypothetical protein M569_09526, partial [Genlisea aurea] Length = 140 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/52 (59%), Positives = 32/52 (61%) Frame = +2 Query: 5 AIVEEQTLDXXXXXXXXXXXXXXXXXXGHRQPITRIRVTSITGYQDSPAVTL 160 A VEEQ LD GHRQPITRIR+TSITGYQDSPAVTL Sbjct: 88 ATVEEQILDKKVIVFKYKKKKHYRRNIGHRQPITRIRITSITGYQDSPAVTL 139 >gb|EOY17212.1| 50S ribosomal protein L21 isoform 2 [Theobroma cacao] Length = 256 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 43 CLQVQKEEKLPKKYWTQTAYYKDKSNKHHWIPRLT 147 CLQVQ+EEKL +KYWT TA Y DK N+HH +PRL+ Sbjct: 186 CLQVQEEEKLSEKYWTSTAEYADKDNRHHRLPRLS 220