BLASTX nr result
ID: Rehmannia22_contig00008958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008958 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF63482.1| hypothetical protein [Potamogeton distinctus] 57 3e-06 >dbj|BAF63482.1| hypothetical protein [Potamogeton distinctus] Length = 76 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 3/75 (4%) Frame = +2 Query: 131 MSGLIDMWTNELAKLRNKGQAIFSSGSAPPSQAADEKRDGSLWWPT---GXXXXXXXXXX 301 MSGL+DMWTNE+AKLR K Q F S PP+ EK+ S+ +P Sbjct: 1 MSGLVDMWTNEVAKLREKSQEFFKRDSTPPTSHVREKQQSSVRYPVLSQALRIKKQPPVT 60 Query: 302 XXSEGSVSMLVDSLS 346 S +VSM+VD +S Sbjct: 61 LCSVAAVSMIVDCVS 75