BLASTX nr result
ID: Rehmannia22_contig00008880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008880 (541 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71928.1| hypothetical protein M569_02828, partial [Genlise... 68 2e-09 >gb|EPS71928.1| hypothetical protein M569_02828, partial [Genlisea aurea] Length = 550 Score = 67.8 bits (164), Expect = 2e-09 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 6/74 (8%) Frame = +3 Query: 6 ATDAMHEGCEISGEDVLREIMDICTYSLREAHEAHRLLTVC-----PDLSSSSPVASPFV 170 ATDA+ EG ++ E+ LREI +IC YSLR +HE HR L +C P S ++ +SPFV Sbjct: 478 ATDAIQEGYGVASENALREIQEICEYSLRASHEDHR-LDLCIDSKPPPTSMATSSSSPFV 536 Query: 171 -LPKVQRGRPKKRG 209 PK RGRP+KRG Sbjct: 537 PPPKAPRGRPRKRG 550