BLASTX nr result
ID: Rehmannia22_contig00008800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008800 (2090 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum] 55 4e-06 >gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum] Length = 497 Score = 55.1 bits (131), Expect(2) = 4e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 1112 ALSDYITAKSANYVAEE*QIFHQPSGSRMEIGFIFLFPLIQTSL 981 AL DYI A+ A +VAEE + FHQP G + E+GF F FP++QTS+ Sbjct: 142 ALFDYIAAELAKFVAEEEEKFHQPPGKQRELGFTFSFPIMQTSI 185 Score = 24.6 bits (52), Expect(2) = 4e-06 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 967 ITWTKGFSIED 935 I WTKGFSI+D Sbjct: 191 IRWTKGFSIDD 201