BLASTX nr result
ID: Rehmannia22_contig00008596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008596 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248148.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 59 7e-07 ref|XP_006366002.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 59 9e-07 >ref|XP_004248148.1| PREDICTED: UPF0420 protein C16orf58 homolog [Solanum lycopersicum] Length = 514 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 413 PFKNKAKEQGWVMSESLLNPGKARLCELVR*D 318 PFK+KAKEQGWVMSESLLNPG+ARLCE+ D Sbjct: 482 PFKSKAKEQGWVMSESLLNPGRARLCEMTTHD 513 >ref|XP_006366002.1| PREDICTED: UPF0420 protein C16orf58 homolog [Solanum tuberosum] Length = 514 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -3 Query: 413 PFKNKAKEQGWVMSESLLNPGKARLCEL 330 PFK+KAKEQGWVMSESLLNPG+ARLCE+ Sbjct: 485 PFKSKAKEQGWVMSESLLNPGRARLCEM 512