BLASTX nr result
ID: Rehmannia22_contig00008578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008578 (358 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59796.1| hypothetical protein M569_15009, partial [Genlise... 55 1e-05 >gb|EPS59796.1| hypothetical protein M569_15009, partial [Genlisea aurea] Length = 169 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/58 (53%), Positives = 34/58 (58%), Gaps = 4/58 (6%) Frame = +1 Query: 196 IQFFSQPFLQTKNPRILTFP----YRKSRNILVFASKDESKLDEWDQMELKFGRMIGE 357 IQF S P + R L P RK R ASK+E LDEWD+MELKFGRMIGE Sbjct: 13 IQFLSHPLKPVRTSRTLLSPPPPPRRKPRIRTASASKNEPNLDEWDRMELKFGRMIGE 70