BLASTX nr result
ID: Rehmannia22_contig00008339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008339 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-li... 65 7e-09 gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus... 65 1e-08 ref|XP_006413625.1| hypothetical protein EUTSA_v10025849mg [Eutr... 64 2e-08 ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-li... 64 2e-08 gb|EOY24496.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theob... 64 2e-08 ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-li... 64 3e-08 ref|XP_006601449.1| PREDICTED: methylsterol monooxygenase 1-1-li... 63 4e-08 ref|XP_006396795.1| hypothetical protein EUTSA_v10028846mg [Eutr... 63 4e-08 gb|AAK61361.1| putative sterol 4-alpha-methyl-oxidase [Arabidops... 63 5e-08 ref|NP_567670.1| sterol C4-methyl oxidase 1-2 [Arabidopsis thali... 63 5e-08 gb|AFK37077.1| unknown [Medicago truncatula] 63 5e-08 ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula... 63 5e-08 gb|AAM65428.1| putative C-4 sterol methyl oxidase [Arabidopsis t... 63 5e-08 ref|XP_002509623.1| C-4 methyl sterol oxidase, putative [Ricinus... 62 6e-08 ref|XP_006368716.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family prot... 62 8e-08 ref|XP_006288336.1| hypothetical protein CARUB_v10001581mg [Caps... 62 8e-08 ref|XP_004159506.1| PREDICTED: methylsterol monooxygenase 1-2-li... 62 8e-08 gb|AAQ13424.1|AF039199_1 sterol-4-methyl-oxidase [Arabidopsis th... 62 8e-08 gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis t... 62 8e-08 ref|NP_192948.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis t... 62 8e-08 >ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum tuberosum] Length = 303 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYRYQKKVLQQL+ +N QNG Sbjct: 255 VFTYCDYIYGTDKGYRYQKKVLQQLKGASNANGEQNG 291 >gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris] Length = 302 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYRYQKK+LQ+L+E + + QNG Sbjct: 255 VFTYCDYIYGTDKGYRYQKKILQKLKEDLTYGEQQNG 291 >ref|XP_006413625.1| hypothetical protein EUTSA_v10025849mg [Eutrema salsugineum] gi|557114795|gb|ESQ55078.1| hypothetical protein EUTSA_v10025849mg [Eutrema salsugineum] Length = 298 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+LQQ++E K + QNG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLQQIKEESKKSNKQNG 293 >ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-like isoform X1 [Glycine max] Length = 359 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYRYQKK+LQ+L+E + + QNG Sbjct: 317 VFTYCDYIYGTDKGYRYQKKILQKLKEELANGVEQNG 353 >gb|EOY24496.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theobroma cacao] Length = 304 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYRY KKVL++L+E ++N QNG Sbjct: 255 VFTYCDYIYGTDKGYRYHKKVLRKLKEESRTNGAQNG 291 >ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-like [Cicer arietinum] Length = 303 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYRYQKK+L++L+E + + QNG Sbjct: 255 VFTYCDYIYGTDKGYRYQKKILRKLKEELTNGAAQNG 291 >ref|XP_006601449.1| PREDICTED: methylsterol monooxygenase 1-1-like [Glycine max] Length = 272 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 336 FTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNGLLH 220 FTYCDYIYGTDKGYRYQKK+LQ+L+E + + QNG L+ Sbjct: 231 FTYCDYIYGTDKGYRYQKKILQKLKEELANGVEQNGGLY 269 >ref|XP_006396795.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum] gi|557097812|gb|ESQ38248.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum] Length = 298 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLRE-GMKSNQVQNGLLHD 217 VFTYCDYIYGTDKGYR+QKK+L+Q++E KSNQ G+ +D Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNQHSGGIKYD 298 >gb|AAK61361.1| putative sterol 4-alpha-methyl-oxidase [Arabidopsis thaliana] Length = 299 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLRE-GMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+LQQ++E KSN++ NG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLQQMKEKSKKSNKLVNG 294 >ref|NP_567670.1| sterol C4-methyl oxidase 1-2 [Arabidopsis thaliana] gi|122178087|sp|Q1EC69.1|SMO12_ARATH RecName: Full=Methylsterol monooxygenase 1-2; AltName: Full=Sterol 4-alpha-methyl-oxidase 1-2; Short=AtSMO1-2 gi|108385258|gb|ABF85767.1| At4g22756 [Arabidopsis thaliana] gi|110738551|dbj|BAF01201.1| hypothetical protein [Arabidopsis thaliana] gi|332659253|gb|AEE84653.1| sterol C4-methyl oxidase 1-2 [Arabidopsis thaliana] Length = 299 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLRE-GMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+LQQ++E KSN++ NG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLQQMKEKSKKSNKLVNG 294 >gb|AFK37077.1| unknown [Medicago truncatula] Length = 303 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKG+RYQKK+LQ+L+E + QNG Sbjct: 255 VFTYCDYIYGTDKGFRYQKKILQKLKEDSTNGAAQNG 291 >ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula] gi|355509852|gb|AES90994.1| Sterol-4-methyl-oxidase [Medicago truncatula] Length = 303 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKG+RYQKK+LQ+L+E + QNG Sbjct: 255 VFTYCDYIYGTDKGFRYQKKILQKLKEDSTNGAAQNG 291 >gb|AAM65428.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana] Length = 299 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLRE-GMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+LQQ++E KSN++ NG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLQQMKEKSKKSNKLVNG 294 >ref|XP_002509623.1| C-4 methyl sterol oxidase, putative [Ricinus communis] gi|223549522|gb|EEF51010.1| C-4 methyl sterol oxidase, putative [Ricinus communis] Length = 243 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCD+IYGTDKGYR+QKKV+++L+EG+++ QNG Sbjct: 194 VFTYCDFIYGTDKGYRFQKKVIKKLKEGLENGGNQNG 230 >ref|XP_006368716.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa] gi|550346803|gb|ERP65285.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa] Length = 304 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCD+IYGTDKGYR+QKK+L++L+EG+++ QNG Sbjct: 255 VFTYCDFIYGTDKGYRFQKKLLRKLKEGVENGGEQNG 291 >ref|XP_006288336.1| hypothetical protein CARUB_v10001581mg [Capsella rubella] gi|482557042|gb|EOA21234.1| hypothetical protein CARUB_v10001581mg [Capsella rubella] Length = 298 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+L+Q++E K + NG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293 >ref|XP_004159506.1| PREDICTED: methylsterol monooxygenase 1-2-like [Cucumis sativus] Length = 300 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQ 241 VFTYCDYIYGTDKGYRYQKK+LQ+L+E +K+++ Sbjct: 255 VFTYCDYIYGTDKGYRYQKKILQKLKEEVKNSE 287 >gb|AAQ13424.1|AF039199_1 sterol-4-methyl-oxidase [Arabidopsis thaliana] Length = 298 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+L+Q++E K + NG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293 >gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana] Length = 298 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+L+Q++E K + NG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293 >ref|NP_192948.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana] gi|75154239|sp|Q8L7W5.1|SMO11_ARATH RecName: Full=Methylsterol monooxygenase 1-1; AltName: Full=Sterol 4-alpha-methyl-oxidase 1-1; Short=AtSMO1-1 gi|21928127|gb|AAM78091.1| AT4g12110/F16J13_180 [Arabidopsis thaliana] gi|23308291|gb|AAN18115.1| At4g12110/F16J13_180 [Arabidopsis thaliana] gi|332657697|gb|AEE83097.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana] Length = 298 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 339 VFTYCDYIYGTDKGYRYQKKVLQQLREGMKSNQVQNG 229 VFTYCDYIYGTDKGYR+QKK+L+Q++E K + NG Sbjct: 257 VFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293