BLASTX nr result
ID: Rehmannia22_contig00008194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008194 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331701.1| predicted protein [Populus trichocarpa] gi|5... 90 4e-16 ref|XP_002317449.1| hypothetical protein POPTR_0011s10900g [Popu... 90 4e-16 ref|XP_004294149.1| PREDICTED: ubiquitin domain-containing prote... 89 6e-16 gb|EMJ15185.1| hypothetical protein PRUPE_ppa013589mg [Prunus pe... 89 6e-16 ref|XP_006356096.1| PREDICTED: ubiquitin domain-containing prote... 88 1e-15 gb|ESW21558.1| hypothetical protein PHAVU_005G080900g [Phaseolus... 88 1e-15 gb|EOY13439.1| Ubiquitin domain-containing protein [Theobroma ca... 88 1e-15 ref|XP_004234078.1| PREDICTED: ubiquitin domain-containing prote... 88 1e-15 ref|XP_004137230.1| PREDICTED: ubiquitin domain-containing prote... 88 1e-15 ref|XP_006442424.1| hypothetical protein CICLE_v10022935mg [Citr... 87 2e-15 ref|XP_006442422.1| hypothetical protein CICLE_v10022935mg [Citr... 87 2e-15 ref|XP_006392791.1| hypothetical protein EUTSA_v10011877mg [Eutr... 87 2e-15 ref|XP_002524525.1| Ubiquitin domain-containing protein, putativ... 87 2e-15 ref|XP_003596315.1| Ubiquitin domain-containing protein [Medicag... 87 2e-15 ref|NP_001238246.1| uncharacterized protein LOC100306399 [Glycin... 87 2e-15 ref|XP_004489012.1| PREDICTED: ubiquitin domain-containing prote... 87 3e-15 gb|AFK44107.1| unknown [Lotus japonicus] 87 3e-15 gb|AFK43379.1| unknown [Lotus japonicus] 87 3e-15 ref|XP_003540499.1| PREDICTED: ubiquitin domain-containing prote... 87 3e-15 gb|EXC10785.1| hypothetical protein L484_002639 [Morus notabilis] 86 4e-15 >ref|XP_002331701.1| predicted protein [Populus trichocarpa] gi|566153708|ref|XP_006370109.1| hypothetical protein POPTR_0001s39570g [Populus trichocarpa] gi|550349288|gb|ERP66678.1| hypothetical protein POPTR_0001s39570g [Populus trichocarpa] Length = 114 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVI+QN DLTVCYDERGAKYELPKYVLSEPTNLIRE+ Sbjct: 69 LAQAIVDSAGVIIQNADLTVCYDERGAKYELPKYVLSEPTNLIRET 114 >ref|XP_002317449.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa] gi|222860514|gb|EEE98061.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa] Length = 114 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQN DLT+CYDERGAKYELPKYVLSEPTNLIRE+ Sbjct: 69 LAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIRET 114 >ref|XP_004294149.1| PREDICTED: ubiquitin domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 114 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQ+ DLT+CYDERGAKYELPKYVLSEPTNLIRES Sbjct: 69 LAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRES 114 >gb|EMJ15185.1| hypothetical protein PRUPE_ppa013589mg [Prunus persica] Length = 114 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQ+ DLT+CYDERGAKYELPKYVLSEPTNLIRES Sbjct: 69 LAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRES 114 >ref|XP_006356096.1| PREDICTED: ubiquitin domain-containing protein 1-like [Solanum tuberosum] Length = 111 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAG+IVQ PDLT+CYDERGAKYELPKYVLSEPTNLIR++ Sbjct: 66 LAQAIVDSAGIIVQAPDLTICYDERGAKYELPKYVLSEPTNLIRDN 111 >gb|ESW21558.1| hypothetical protein PHAVU_005G080900g [Phaseolus vulgaris] Length = 114 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQ+ DLTVCYDERGAKYELPKYVLSEPTNLIR+S Sbjct: 69 LAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRDS 114 >gb|EOY13439.1| Ubiquitin domain-containing protein [Theobroma cacao] Length = 114 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQN DLT+CYDERGAKYELPKYVLSEPTNLI++S Sbjct: 69 LAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIQDS 114 >ref|XP_004234078.1| PREDICTED: ubiquitin domain-containing protein 1-like [Solanum lycopersicum] Length = 111 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAG+IVQ PDLT+CYDERGAKYELPKYVLSEPTNLIR++ Sbjct: 66 LAQAIVDSAGIIVQAPDLTICYDERGAKYELPKYVLSEPTNLIRDN 111 >ref|XP_004137230.1| PREDICTED: ubiquitin domain-containing protein 1-like [Cucumis sativus] Length = 115 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQN DLT+CYDERGAKYELP YVLSEPTNLIR+S Sbjct: 69 LAQAIVDSAGVIVQNADLTICYDERGAKYELPNYVLSEPTNLIRDS 114 >ref|XP_006442424.1| hypothetical protein CICLE_v10022935mg [Citrus clementina] gi|568848107|ref|XP_006477863.1| PREDICTED: ubiquitin domain-containing protein 1-like [Citrus sinensis] gi|557544686|gb|ESR55664.1| hypothetical protein CICLE_v10022935mg [Citrus clementina] Length = 114 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRE 137 LAQAIVDSAGVIVQ+ DLT+CYDERGAKYELPKYVLSEPTNLIRE Sbjct: 69 LAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRE 113 >ref|XP_006442422.1| hypothetical protein CICLE_v10022935mg [Citrus clementina] gi|557544684|gb|ESR55662.1| hypothetical protein CICLE_v10022935mg [Citrus clementina] Length = 79 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRE 137 LAQAIVDSAGVIVQ+ DLT+CYDERGAKYELPKYVLSEPTNLIRE Sbjct: 34 LAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIRE 78 >ref|XP_006392791.1| hypothetical protein EUTSA_v10011877mg [Eutrema salsugineum] gi|557089369|gb|ESQ30077.1| hypothetical protein EUTSA_v10011877mg [Eutrema salsugineum] Length = 114 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQN DLT CYDERGAKYELPKYVLSEPTNL+ ES Sbjct: 69 LAQAIVDSAGVIVQNTDLTTCYDERGAKYELPKYVLSEPTNLVEES 114 >ref|XP_002524525.1| Ubiquitin domain-containing protein, putative [Ricinus communis] gi|223536199|gb|EEF37852.1| Ubiquitin domain-containing protein, putative [Ricinus communis] Length = 114 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIR 134 LAQAIVDSAGVIVQN DLT+CYDERGAKYELPKYVLSEPTNLIR Sbjct: 69 LAQAIVDSAGVIVQNADLTICYDERGAKYELPKYVLSEPTNLIR 112 >ref|XP_003596315.1| Ubiquitin domain-containing protein [Medicago truncatula] gi|355485363|gb|AES66566.1| Ubiquitin domain-containing protein [Medicago truncatula] gi|388514353|gb|AFK45238.1| unknown [Medicago truncatula] Length = 114 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQ+ DLTVCYDERGAKYELPKYVLSEPTN+I+ES Sbjct: 69 LAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNMIQES 114 >ref|NP_001238246.1| uncharacterized protein LOC100306399 [Glycine max] gi|255628415|gb|ACU14552.1| unknown [Glycine max] Length = 114 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQ+ DLTVCYDERGAKYELPKYVLSEPTNLIR++ Sbjct: 69 LAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRDT 114 >ref|XP_004489012.1| PREDICTED: ubiquitin domain-containing protein 2-like [Cicer arietinum] Length = 117 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQ+ DLTVCYDERGAKYELPKYVLSEPTNLI++S Sbjct: 72 LAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIQDS 117 >gb|AFK44107.1| unknown [Lotus japonicus] Length = 114 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRE 137 LAQAIVDSAGVIVQ+ DLTVCYDERGAKYELPKYVLSEPTNLIR+ Sbjct: 69 LAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD 113 >gb|AFK43379.1| unknown [Lotus japonicus] Length = 114 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRE 137 LAQAIVDSAGVIVQ+ DLTVCYDERGAKYELPKYVLSEPTNLIR+ Sbjct: 69 LAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRD 113 >ref|XP_003540499.1| PREDICTED: ubiquitin domain-containing protein 1-like [Glycine max] Length = 114 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQ IVDSAGVIVQ+ DLTVCYDERGAKYELPKYVLSEPTNLIR+S Sbjct: 69 LAQVIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIRDS 114 >gb|EXC10785.1| hypothetical protein L484_002639 [Morus notabilis] Length = 114 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 LAQAIVDSAGVIVQNPDLTVCYDERGAKYELPKYVLSEPTNLIRES 140 LAQAIVDSAGVIVQ+ DLT+CYDERGAKYELPKYVLSEPTNLI++S Sbjct: 69 LAQAIVDSAGVIVQSADLTICYDERGAKYELPKYVLSEPTNLIQDS 114