BLASTX nr result
ID: Rehmannia22_contig00008168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00008168 (630 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 43 3e-07 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -2 Query: 260 RINCTVWEDCVDKILPYLNDG*FEPIIIVLQMCRAKV 150 +I CTVW+D V K+ P+ +P+II+LQ CR KV Sbjct: 176 QIKCTVWDDHVSKLEPFYQSTKQDPVIILLQFCRVKV 212 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = -3 Query: 448 DIIGKVVSMHSTQTKELAGRTTRFIEIILEDLE 350 D+IG VV +++ Q K +AG+ TR I+ +LED E Sbjct: 141 DLIGMVVEINTPQDKVIAGKATRLIDFLLEDTE 173