BLASTX nr result
ID: Rehmannia22_contig00007947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00007947 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268568.1| PREDICTED: uncharacterized protein LOC100241... 59 7e-07 ref|XP_006350558.1| PREDICTED: uncharacterized protein LOC102578... 58 1e-06 >ref|XP_002268568.1| PREDICTED: uncharacterized protein LOC100241849 [Vitis vinifera] gi|302144033|emb|CBI23138.3| unnamed protein product [Vitis vinifera] Length = 292 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 10 VRPNFLDFPVMDFGAVYGMRRAFSDGDIK 96 +RPNFLDFP MDFGA YGMRRAFSDGDIK Sbjct: 184 MRPNFLDFPGMDFGAAYGMRRAFSDGDIK 212 >ref|XP_006350558.1| PREDICTED: uncharacterized protein LOC102578992 [Solanum tuberosum] Length = 279 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 4 APVRPNFLDFPVMDFGAVYGMRRAFSDGDIK 96 AP+RPNF+DF MDFGAVYGMRR+FS+GDIK Sbjct: 170 APMRPNFIDFGGMDFGAVYGMRRSFSEGDIK 200