BLASTX nr result
ID: Rehmannia22_contig00007213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00007213 (638 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT33534.1| hypothetical protein F775_15647 [Aegilops tauschii] 61 3e-07 >gb|EMT33534.1| hypothetical protein F775_15647 [Aegilops tauschii] Length = 968 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/90 (32%), Positives = 50/90 (55%) Frame = +3 Query: 315 PGTQIRAKPKVIVDALRALKPAQKSAVIEMGFGSLFDLKIDDFNKKLTYWLVENFNALSS 494 P + RA P +V A + + + SA+ +M F SL ++K D+ +L+ WL ++ S Sbjct: 765 PADRNRASPSALVTACKDMSDERMSAIDDMDFTSLRNIKCDNLFNRLSQWLAGLYDPDSR 824 Query: 495 ELIFEDGRRIHIEREDVGRVMGFPDGDVVI 584 E++ RR+ + E V R+MG P GD+ + Sbjct: 825 EVVVPGRRRLSVNEESVHRIMGVPRGDIAV 854