BLASTX nr result
ID: Rehmannia22_contig00007199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00007199 (751 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68421.1| hypothetical protein M569_06338 [Genlisea aurea] 57 9e-06 >gb|EPS68421.1| hypothetical protein M569_06338 [Genlisea aurea] Length = 418 Score = 56.6 bits (135), Expect = 9e-06 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +1 Query: 598 MGDDNLMDVNLTDLDLNQEP-TDPPLPSVARVGFLLNDIETAQYSIDERIR 747 M D +LM+VNLTDLDLNQEP DPP V G +LND+E+A I+ERIR Sbjct: 1 MDDGDLMEVNLTDLDLNQEPAADPPFHRVG-YGSILNDLESAHNRIEERIR 50