BLASTX nr result
ID: Rehmannia22_contig00007064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00007064 (341 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157540.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_004142406.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_002280702.2| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 emb|CBI21484.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_002310592.2| pentatricopeptide repeat-containing family p... 72 6e-11 ref|XP_004306202.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 gb|EPS61204.1| hypothetical protein M569_13595 [Genlisea aurea] 70 3e-10 ref|XP_004987089.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_006354721.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_006404655.1| hypothetical protein EUTSA_v10000053mg [Eutr... 69 5e-10 ref|XP_006296049.1| hypothetical protein CARUB_v10025197mg [Caps... 69 5e-10 ref|XP_002878586.1| pentatricopeptide repeat-containing protein ... 69 5e-10 ref|NP_179798.1| pentatricopeptide repeat-containing protein [Ar... 69 5e-10 gb|ESW15249.1| hypothetical protein PHAVU_007G057100g [Phaseolus... 69 6e-10 ref|XP_002468209.1| hypothetical protein SORBIDRAFT_01g041740 [S... 69 6e-10 ref|XP_002276196.1| PREDICTED: pentatricopeptide repeat-containi... 69 6e-10 ref|NP_001141725.1| hypothetical protein [Zea mays] gi|194705708... 69 6e-10 ref|XP_006428089.1| hypothetical protein CICLE_v10027512mg [Citr... 69 8e-10 ref|XP_004496732.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002463808.1| hypothetical protein SORBIDRAFT_01g006560 [S... 68 1e-09 >ref|XP_004157540.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Cucumis sativus] Length = 782 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRDATRFHHFK+GSCSCRDYW Sbjct: 749 IKFISKLVGREIIVRDATRFHHFKDGSCSCRDYW 782 >ref|XP_004142406.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Cucumis sativus] Length = 782 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRDATRFHHFK+GSCSCRDYW Sbjct: 749 IKFISKLVGREIIVRDATRFHHFKDGSCSCRDYW 782 >ref|XP_002280702.2| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Vitis vinifera] Length = 785 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRDATRFHHFKNG CSCRDYW Sbjct: 752 IKFISKLVGREIIVRDATRFHHFKNGLCSCRDYW 785 >emb|CBI21484.3| unnamed protein product [Vitis vinifera] Length = 590 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRDATRFHHFKNG CSCRDYW Sbjct: 557 IKFISKLVGREIIVRDATRFHHFKNGLCSCRDYW 590 >ref|XP_002310592.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550334248|gb|EEE91042.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 785 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV+REIIVRDATRFHHFK+GSCSC+DYW Sbjct: 752 IKFISKLVDREIIVRDATRFHHFKDGSCSCKDYW 785 >ref|XP_004306202.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Fragaria vesca subsp. vesca] Length = 1013 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REII+RD TRFHHFKNG+CSCRDYW Sbjct: 980 IKFISKLVGREIILRDTTRFHHFKNGTCSCRDYW 1013 >gb|EPS61204.1| hypothetical protein M569_13595 [Genlisea aurea] Length = 811 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 6 KFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 KFISKLV REI+VRDATRFHHF++GSCSCRDYW Sbjct: 779 KFISKLVGREIVVRDATRFHHFRDGSCSCRDYW 811 >ref|XP_004987089.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Setaria italica] Length = 636 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFIS++V REIIVRD+ RFHHFKNGSCSCRDYW Sbjct: 603 IKFISRIVQREIIVRDSNRFHHFKNGSCSCRDYW 636 >ref|XP_006354721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Solanum tuberosum] Length = 786 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REII+RDATRFHHFK G CSCRDYW Sbjct: 753 IKFISKLVGREIILRDATRFHHFKGGFCSCRDYW 786 >ref|XP_006404655.1| hypothetical protein EUTSA_v10000053mg [Eutrema salsugineum] gi|557105783|gb|ESQ46108.1| hypothetical protein EUTSA_v10000053mg [Eutrema salsugineum] Length = 785 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRD TRFHHFK+G CSCRDYW Sbjct: 752 IKFISKLVGREIIVRDTTRFHHFKDGFCSCRDYW 785 >ref|XP_006296049.1| hypothetical protein CARUB_v10025197mg [Capsella rubella] gi|482564757|gb|EOA28947.1| hypothetical protein CARUB_v10025197mg [Capsella rubella] Length = 795 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRD TRFHHFK+G CSCRDYW Sbjct: 762 IKFISKLVGREIIVRDTTRFHHFKDGFCSCRDYW 795 >ref|XP_002878586.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324425|gb|EFH54845.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 786 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRD TRFHHFK+G CSCRDYW Sbjct: 753 IKFISKLVGREIIVRDTTRFHHFKDGFCSCRDYW 786 >ref|NP_179798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206010|sp|Q9SHZ8.1|PP168_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g22070 gi|4587589|gb|AAD25817.1| hypothetical protein [Arabidopsis thaliana] gi|330252165|gb|AEC07259.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 786 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISKLV REIIVRD TRFHHFK+G CSCRDYW Sbjct: 753 IKFISKLVGREIIVRDTTRFHHFKDGFCSCRDYW 786 >gb|ESW15249.1| hypothetical protein PHAVU_007G057100g [Phaseolus vulgaris] Length = 786 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IK+ISKLV REIIVRD TRFHHFK+GSCSC+DYW Sbjct: 753 IKYISKLVKREIIVRDTTRFHHFKDGSCSCQDYW 786 >ref|XP_002468209.1| hypothetical protein SORBIDRAFT_01g041740 [Sorghum bicolor] gi|241922063|gb|EER95207.1| hypothetical protein SORBIDRAFT_01g041740 [Sorghum bicolor] Length = 635 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IK ISK+V REIIVRD+ RFHHFKNGSCSCRDYW Sbjct: 602 IKLISKIVQREIIVRDSNRFHHFKNGSCSCRDYW 635 >ref|XP_002276196.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Vitis vinifera] gi|296081235|emb|CBI17979.3| unnamed protein product [Vitis vinifera] Length = 742 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 6 KFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 K ISKLVNREI+VRDA RFHHFKNG CSCRDYW Sbjct: 710 KLISKLVNREIVVRDANRFHHFKNGVCSCRDYW 742 >ref|NP_001141725.1| hypothetical protein [Zea mays] gi|194705708|gb|ACF86938.1| unknown [Zea mays] gi|413956425|gb|AFW89074.1| hypothetical protein ZEAMMB73_742653 [Zea mays] Length = 635 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IK ISK+V REIIVRD+ RFHHFKNGSCSCRDYW Sbjct: 602 IKLISKIVQREIIVRDSNRFHHFKNGSCSCRDYW 635 >ref|XP_006428089.1| hypothetical protein CICLE_v10027512mg [Citrus clementina] gi|568819548|ref|XP_006464311.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Citrus sinensis] gi|557530079|gb|ESR41329.1| hypothetical protein CICLE_v10027512mg [Citrus clementina] Length = 785 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFI KLV+REI+VRDATRFHHFK G CSCRDYW Sbjct: 752 IKFICKLVDREIVVRDATRFHHFKKGLCSCRDYW 785 >ref|XP_004496732.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Cicer arietinum] Length = 782 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IK+IS LV REIIVRDATRFHHFK+GSCSC+DYW Sbjct: 749 IKYISVLVGREIIVRDATRFHHFKDGSCSCQDYW 782 >ref|XP_002463808.1| hypothetical protein SORBIDRAFT_01g006560 [Sorghum bicolor] gi|241917662|gb|EER90806.1| hypothetical protein SORBIDRAFT_01g006560 [Sorghum bicolor] Length = 803 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 3 IKFISKLVNREIIVRDATRFHHFKNGSCSCRDYW 104 IKFISK+V+REIIVRDATRFHHF++G CSC+DYW Sbjct: 770 IKFISKVVDREIIVRDATRFHHFRDGYCSCKDYW 803