BLASTX nr result
ID: Rehmannia22_contig00006948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00006948 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ12222.1| hypothetical protein PRUPE_ppa019882mg, partial [... 55 1e-05 >gb|EMJ12222.1| hypothetical protein PRUPE_ppa019882mg, partial [Prunus persica] Length = 86 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 WDLNMKLFRAAGLFAGSIVLMRQYGDLMAI 92 W LNMKL RAAGLFAGSI+LMR YGDLMAI Sbjct: 57 WALNMKLLRAAGLFAGSILLMRSYGDLMAI 86