BLASTX nr result
ID: Rehmannia22_contig00006270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00006270 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed b... 112 5e-23 emb|CBI23205.3| unnamed protein product [Vitis vinifera] 112 5e-23 gb|EXB77047.1| hypothetical protein L484_014173 [Morus notabilis] 112 7e-23 gb|EMJ13114.1| hypothetical protein PRUPE_ppa010528mg [Prunus pe... 110 1e-22 gb|EOY28769.1| Pyridoxal phosphate-dependent enzyme [Theobroma c... 108 7e-22 ref|XP_006348146.1| PREDICTED: proline synthase co-transcribed b... 108 9e-22 gb|ESW18506.1| hypothetical protein PHAVU_006G047100g [Phaseolus... 107 1e-21 ref|XP_006467399.1| PREDICTED: proline synthase co-transcribed b... 107 2e-21 ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed b... 107 2e-21 emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] 107 2e-21 ref|XP_002529455.1| proline synthetase associated protein, putat... 106 4e-21 ref|XP_006602187.1| PREDICTED: 1,4-alpha-glucan-branching enzyme... 105 6e-21 ref|XP_004248334.1| PREDICTED: proline synthase co-transcribed b... 105 6e-21 ref|XP_003532139.1| PREDICTED: proline synthase co-transcribed b... 105 6e-21 ref|XP_006449777.1| hypothetical protein CICLE_v10016262mg [Citr... 105 8e-21 ref|XP_004232692.1| PREDICTED: proline synthase co-transcribed b... 104 1e-20 ref|XP_006475026.1| PREDICTED: proline synthase co-transcribed b... 104 1e-20 ref|XP_006352515.1| PREDICTED: proline synthase co-transcribed b... 104 1e-20 ref|XP_006452430.1| hypothetical protein CICLE_v10009301mg [Citr... 104 1e-20 ref|NP_001190850.1| putative pyridoxal phosphate-dependent enzym... 104 1e-20 >ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Vitis vinifera] Length = 264 Score = 112 bits (280), Expect = 5e-23 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 173 TLANCR+EVCK+LG++EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ Sbjct: 206 TLANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 262 >emb|CBI23205.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 112 bits (280), Expect = 5e-23 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 173 TLANCR+EVCK+LG++EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ Sbjct: 253 TLANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 309 >gb|EXB77047.1| hypothetical protein L484_014173 [Morus notabilis] Length = 316 Score = 112 bits (279), Expect = 7e-23 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQT 176 TLANCR+EVCKALG++EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFG REYPKKQ+ Sbjct: 259 TLANCRSEVCKALGIAEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYPKKQS 316 >gb|EMJ13114.1| hypothetical protein PRUPE_ppa010528mg [Prunus persica] Length = 246 Score = 110 bits (276), Expect = 1e-22 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 179 TLANCRTEVCKALG+ EEQCELSMGMS DFELAIE+GSTNVRIGSTIFGAREYPKK +N Sbjct: 188 TLANCRTEVCKALGIPEEQCELSMGMSADFELAIELGSTNVRIGSTIFGAREYPKKLSN 246 >gb|EOY28769.1| Pyridoxal phosphate-dependent enzyme [Theobroma cacao] Length = 266 Score = 108 bits (270), Expect = 7e-22 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 170 TLANCR+EVCKALG+ EEQCELSMGMSGDFE AIEMGSTNVRIGSTIFGAREYPKK Sbjct: 210 TLANCRSEVCKALGIPEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGAREYPKK 265 >ref|XP_006348146.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum tuberosum] Length = 279 Score = 108 bits (269), Expect = 9e-22 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 179 TLA CR+EVC+ALG+SE+QC+LSMGMSGDFELA+EMGSTNVR+GSTIFGAREYP KQ+N Sbjct: 221 TLARCRSEVCEALGISEDQCDLSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPTKQSN 279 >gb|ESW18506.1| hypothetical protein PHAVU_006G047100g [Phaseolus vulgaris] Length = 245 Score = 107 bits (268), Expect = 1e-21 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 173 TL+NCR+EVCKAL M EEQCELSMGMSGDFELAIEMGSTNVR+GSTIFG REYPKKQ Sbjct: 188 TLSNCRSEVCKALEMPEEQCELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKKQ 244 >ref|XP_006467399.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Citrus sinensis] Length = 269 Score = 107 bits (267), Expect = 2e-21 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 170 TLA CR+EVCKALG+ EEQC+LSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK Sbjct: 213 TLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 268 >ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Vitis vinifera] gi|297737470|emb|CBI26671.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 107 bits (266), Expect = 2e-21 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 6 LANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 179 L NCR EVCKALGM+EEQCELSMGMSGDFE AIEMGSTNVRIGSTIFG REYPKK+ N Sbjct: 188 LLNCRIEVCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKEQN 245 >emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] Length = 245 Score = 107 bits (266), Expect = 2e-21 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 6 LANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 179 L NCR EVCKALGM+EEQCELSMGMSGDFE AIEMGSTNVRIGSTIFG REYPKK+ N Sbjct: 188 LLNCRIEVCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKEQN 245 >ref|XP_002529455.1| proline synthetase associated protein, putative [Ricinus communis] gi|223531071|gb|EEF32921.1| proline synthetase associated protein, putative [Ricinus communis] Length = 245 Score = 106 bits (264), Expect = 4e-21 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = +3 Query: 6 LANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 179 L+NCR EVCKALGM+E+ CELSMGMSGDFE AIEMGSTNVR+GSTIFG REYPKKQ+N Sbjct: 188 LSNCRLEVCKALGMAEDHCELSMGMSGDFEQAIEMGSTNVRVGSTIFGPREYPKKQSN 245 >ref|XP_006602187.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic-like isoform X2 [Glycine max] Length = 596 Score = 105 bits (262), Expect = 6e-21 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 173 TL+NCRTEVCKAL M EE+CELSMGMSGDFELAIEMGSTNVRIGSTIFG REY KKQ Sbjct: 188 TLSNCRTEVCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKQ 244 >ref|XP_004248334.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum lycopersicum] Length = 243 Score = 105 bits (262), Expect = 6e-21 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 173 TL NCRTEVCK LGM+E +CELSMGMS DFELAIEMGSTNVRIGSTIFG REYPKKQ Sbjct: 187 TLLNCRTEVCKVLGMAESRCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPKKQ 243 >ref|XP_003532139.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like isoformX1 [Glycine max] Length = 244 Score = 105 bits (262), Expect = 6e-21 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 173 TL+NCRTEVCKAL M EE+CELSMGMSGDFELAIEMGSTNVRIGSTIFG REY KKQ Sbjct: 188 TLSNCRTEVCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKQ 244 >ref|XP_006449777.1| hypothetical protein CICLE_v10016262mg [Citrus clementina] gi|557552388|gb|ESR63017.1| hypothetical protein CICLE_v10016262mg [Citrus clementina] Length = 269 Score = 105 bits (261), Expect = 8e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 170 TLA CR+EVCKALG+ EEQC+LSMGMSGDFELAIEMGSTNVRIGSTIFGAREYP K Sbjct: 213 TLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPPK 268 >ref|XP_004232692.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum lycopersicum] Length = 283 Score = 104 bits (260), Expect = 1e-20 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 170 TLA CR+EVC+ALG+SE+QCELSMGMSGDFELA+EMGSTNVR+GSTIFGAREYP K Sbjct: 228 TLAKCRSEVCEALGISEDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPTK 283 >ref|XP_006475026.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Citrus sinensis] Length = 245 Score = 104 bits (259), Expect = 1e-20 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 179 TL NCR EVCKALGM+E+QCELSMGMSGDFE AIEMGST+VRIGSTIFG REY KKQ N Sbjct: 187 TLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAKKQQN 245 >ref|XP_006352515.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum tuberosum] Length = 243 Score = 104 bits (259), Expect = 1e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 173 TL NCRTEVCK LGM+E +CELSMGMS DFELAIEMGSTNVRIGSTIFG REYPK+Q Sbjct: 187 TLLNCRTEVCKVLGMAESRCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPKRQ 243 >ref|XP_006452430.1| hypothetical protein CICLE_v10009301mg [Citrus clementina] gi|557555656|gb|ESR65670.1| hypothetical protein CICLE_v10009301mg [Citrus clementina] Length = 245 Score = 104 bits (259), Expect = 1e-20 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQTN 179 TL NCR EVCKALGM+E+QCELSMGMSGDFE AIEMGST+VRIGSTIFG REY KKQ N Sbjct: 187 TLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAKKQQN 245 >ref|NP_001190850.1| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] gi|332659862|gb|AEE85262.1| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] Length = 254 Score = 104 bits (259), Expect = 1e-20 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = +3 Query: 3 TLANCRTEVCKALGMSEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQT 176 TL+NCR +VCKALGM+E+Q ELSMGMSGDFELAIEMGSTNVR+GSTIFG REYPKK T Sbjct: 197 TLSNCRADVCKALGMAEDQFELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKKTT 254