BLASTX nr result
ID: Rehmannia22_contig00005551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00005551 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006408388.1| hypothetical protein EUTSA_v10021615mg [Eutr... 91 2e-16 ref|XP_002884335.1| thioredoxin F-type 1 [Arabidopsis lyrata sub... 91 2e-16 gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus... 90 4e-16 ref|XP_006345775.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 89 5e-16 ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, part... 89 5e-16 ref|XP_004239649.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 89 5e-16 ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] gi|... 89 5e-16 sp|O48897.1|TRXF_BRANA RecName: Full=Thioredoxin F-type, chlorop... 89 6e-16 gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] 87 2e-15 ref|XP_006852197.1| hypothetical protein AMTR_s00049p00119540 [A... 87 2e-15 gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] 87 2e-15 ref|NP_001235872.1| uncharacterized protein LOC100499776 [Glycin... 87 2e-15 ref|XP_006400178.1| hypothetical protein EUTSA_v10014778mg [Eutr... 87 3e-15 gb|AFK48258.1| unknown [Lotus japonicus] 87 3e-15 gb|AFK37418.1| unknown [Lotus japonicus] 87 3e-15 ref|XP_002873774.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata... 87 3e-15 ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus commun... 86 5e-15 ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|111354... 86 7e-15 ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 86 7e-15 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 86 7e-15 >ref|XP_006408388.1| hypothetical protein EUTSA_v10021615mg [Eutrema salsugineum] gi|557109534|gb|ESQ49841.1| hypothetical protein EUTSA_v10021615mg [Eutrema salsugineum] Length = 181 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARSI 153 DCN +NRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DDLV AIE ARS+ Sbjct: 128 DCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSV 178 >ref|XP_002884335.1| thioredoxin F-type 1 [Arabidopsis lyrata subsp. lyrata] gi|297330175|gb|EFH60594.1| thioredoxin F-type 1 [Arabidopsis lyrata subsp. lyrata] Length = 178 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARSI 153 DCN +NRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DDLV AIE ARS+ Sbjct: 125 DCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSV 175 >gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus vulgaris] Length = 181 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENAR 147 DCN +NRPLAKELGIKVVPTFKILKDNK+VKEVTGAK DDLV AI+N R Sbjct: 131 DCNQDNRPLAKELGIKVVPTFKILKDNKVVKEVTGAKFDDLVAAIDNVR 179 >ref|XP_006345775.1| PREDICTED: thioredoxin F1, chloroplastic-like [Solanum tuberosum] Length = 231 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +NRPLAKELGIKVVPTFKILK+NKIVKEVTGAK+DDLV AIE RS Sbjct: 181 DCNQDNRPLAKELGIKVVPTFKILKNNKIVKEVTGAKLDDLVAAIEGVRS 230 >ref|XP_006298548.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] gi|482567257|gb|EOA31446.1| hypothetical protein CARUB_v10014629mg, partial [Capsella rubella] Length = 209 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +NRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DDLV AIE ARS Sbjct: 155 DCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARS 204 >ref|XP_004239649.1| PREDICTED: thioredoxin F1, chloroplastic-like [Solanum lycopersicum] Length = 182 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +NRPLAKELGIKVVPTFKILK+NKIVKEVTGAK+DDLV AIE RS Sbjct: 132 DCNQDNRPLAKELGIKVVPTFKILKNNKIVKEVTGAKLDDLVAAIEGVRS 181 >ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] gi|27735269|sp|Q9XFH8.2|TRXF1_ARATH RecName: Full=Thioredoxin F1, chloroplastic; Short=AtTrxf1; AltName: Full=Thioredoxin F2; Short=AtTrxf2; Flags: Precursor gi|6728989|gb|AAF26987.1|AC018363_32 thioredoxin f1 [Arabidopsis thaliana] gi|17529210|gb|AAL38832.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|20466041|gb|AAM20355.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|21537004|gb|AAM61345.1| thioredoxin f1 [Arabidopsis thaliana] gi|332640331|gb|AEE73852.1| thioredoxin F-type 1 [Arabidopsis thaliana] Length = 178 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +NRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DDLV AIE ARS Sbjct: 125 DCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARS 174 >sp|O48897.1|TRXF_BRANA RecName: Full=Thioredoxin F-type, chloroplastic; Short=Trx-F; Flags: Precursor gi|2921094|gb|AAC04671.1| thioredoxin-f [Brassica napus] Length = 182 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN ENRPLAKELGI+VVPTFKILKDN++VKEVTGAK DDLV AIE ARS Sbjct: 128 DCNPENRPLAKELGIRVVPTFKILKDNQVVKEVTGAKYDDLVAAIETARS 177 >gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] Length = 178 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +NRPL KELGI+VVPTFKILKDNK+VKEVTGAK DDLV AIE ARS Sbjct: 125 DCNPDNRPLPKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARS 174 >ref|XP_006852197.1| hypothetical protein AMTR_s00049p00119540 [Amborella trichopoda] gi|548855801|gb|ERN13664.1| hypothetical protein AMTR_s00049p00119540 [Amborella trichopoda] Length = 181 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN EN+PLAKELGI+VVPTFKILK+NK+VKEVTGAK+DDLV AI+ RS Sbjct: 130 DCNQENKPLAKELGIRVVPTFKILKENKVVKEVTGAKLDDLVAAIDTVRS 179 >gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] Length = 175 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +NRPLAKELGIKVVPTFKILK+NK+VKEVTGAK+D+L+ AIE+ RS Sbjct: 125 DCNQDNRPLAKELGIKVVPTFKILKNNKVVKEVTGAKLDNLIAAIEDVRS 174 >ref|NP_001235872.1| uncharacterized protein LOC100499776 [Glycine max] gi|255626459|gb|ACU13574.1| unknown [Glycine max] Length = 181 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN ENRPLAKELGIK VPTFKILKDNK+VKEVTGAK DDLV AI+ RS Sbjct: 131 DCNQENRPLAKELGIKAVPTFKILKDNKVVKEVTGAKYDDLVDAIDKVRS 180 >ref|XP_006400178.1| hypothetical protein EUTSA_v10014778mg [Eutrema salsugineum] gi|557101268|gb|ESQ41631.1| hypothetical protein EUTSA_v10014778mg [Eutrema salsugineum] Length = 186 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +N+PLAKELGI+VVPTFKILKDNK++KEVTGAK +DLV AIE ARS Sbjct: 136 DCNEDNKPLAKELGIRVVPTFKILKDNKVIKEVTGAKFEDLVAAIEAARS 185 >gb|AFK48258.1| unknown [Lotus japonicus] Length = 179 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +N+PLAKELGIKVVPTFKILKD+KIVKE+TGAK DDLV AIE RS Sbjct: 129 DCNQDNKPLAKELGIKVVPTFKILKDSKIVKEITGAKYDDLVAAIETVRS 178 >gb|AFK37418.1| unknown [Lotus japonicus] Length = 179 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +N+PLAKELGIKVVPTFKILKD+KIVKE+TGAK DDLV AIE RS Sbjct: 129 DCNQDNKPLAKELGIKVVPTFKILKDSKIVKEITGAKYDDLVAAIETVRS 178 >ref|XP_002873774.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata] gi|297319611|gb|EFH50033.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata] Length = 186 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN EN+PLAKELGI+VVPTFKILKDNK+VKEVTGAK +DL+ AIE ARS Sbjct: 136 DCNQENKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARS 185 >ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus communis] gi|223545881|gb|EEF47384.1| thioredoxin f-type, putative [Ricinus communis] Length = 186 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +N+PLAKELGI+VVPTFKILKDNK+VKEVTG+K DDLV AIE RS Sbjct: 136 DCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGSKFDDLVAAIEAVRS 185 >ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|11135405|sp|Q9XFH9.1|TRXF2_ARATH RecName: Full=Thioredoxin F2, chloroplastic; Short=AtTrxf2; AltName: Full=Thioredoxin F1; Short=AtTrxf1; Flags: Precursor gi|4973254|gb|AAD35004.1|AF144386_1 thioredoxin f2 [Arabidopsis thaliana] gi|13878187|gb|AAK44171.1|AF370356_1 putative thioredoxin f2 protein [Arabidopsis thaliana] gi|9759122|dbj|BAB09607.1| thioredoxin f2 [Arabidopsis thaliana] gi|16323396|gb|AAL15192.1| putative thioredoxin f2 protein [Arabidopsis thaliana] gi|332004905|gb|AED92288.1| thioredoxin F2 [Arabidopsis thaliana] Length = 185 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +N+PLAKELGI+VVPTFKILKDNK+VKEVTGAK +DL+ AIE ARS Sbjct: 135 DCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARS 184 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Length = 182 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +N+PLAKELGIKVVPTFKILKD+KIVKEVTGAK DDLV AI+ RS Sbjct: 132 DCNQDNKPLAKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRS 181 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 1 DCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDDLVVAIENARS 150 DCN +N+PLAKELGIKVVPTFKILKD+KIVKEVTGAK DDLV AI+ RS Sbjct: 136 DCNQDNKPLAKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRS 185