BLASTX nr result
ID: Rehmannia22_contig00005518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00005518 (447 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q38732.1|DAG_ANTMA RecName: Full=DAG protein, chloroplastic; ... 68 1e-09 gb|EPS69137.1| hypothetical protein M569_05632, partial [Genlise... 57 3e-06 >sp|Q38732.1|DAG_ANTMA RecName: Full=DAG protein, chloroplastic; Flags: Precursor gi|1200205|emb|CAA65064.1| DAG [Antirrhinum majus] Length = 230 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -1 Query: 447 KQNRGSKYKSKAYVRQRDGPPAERRKPRQEATPESAS 337 KQ+R SKYKSKAYVRQRDGPPAE+R+P+QEATPES++ Sbjct: 194 KQSRSSKYKSKAYVRQRDGPPAEQRRPKQEATPESST 230 >gb|EPS69137.1| hypothetical protein M569_05632, partial [Genlisea aurea] Length = 220 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 447 KQNRGSKYKSKAYVRQRDGPPAERRKPRQEATPESAS 337 KQ R SKYKSKAYVRQRDGPP RK RQE TPESA+ Sbjct: 186 KQTRSSKYKSKAYVRQRDGPP--DRKSRQETTPESAA 220