BLASTX nr result
ID: Rehmannia22_contig00004402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00004402 (605 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476396.1| PREDICTED: abscisic acid receptor PYL8-like ... 79 1e-12 ref|XP_006439365.1| hypothetical protein CICLE_v10022206mg [Citr... 79 1e-12 ref|XP_006439364.1| hypothetical protein CICLE_v10022206mg [Citr... 79 1e-12 ref|XP_002321450.1| hypothetical protein POPTR_0015s02210g [Popu... 75 1e-11 ref|XP_004145925.1| PREDICTED: abscisic acid receptor PYL8-like ... 75 2e-11 gb|AEK99284.1| ABA receptor, partial [Cucumis sativus] 75 2e-11 ref|XP_002270037.2| PREDICTED: abscisic acid receptor PYL8 [Viti... 75 2e-11 ref|XP_002304553.1| hypothetical protein POPTR_0003s13900g [Popu... 75 2e-11 emb|CBI22536.3| unnamed protein product [Vitis vinifera] 75 2e-11 emb|CBI34472.3| unnamed protein product [Vitis vinifera] 75 2e-11 gb|ESW12989.1| hypothetical protein PHAVU_008G158300g [Phaseolus... 74 3e-11 ref|XP_003541499.1| PREDICTED: abscisic acid receptor PYL8-like ... 74 3e-11 gb|EOY24998.1| Regulatory components of ABA receptor 3 [Theobrom... 73 5e-11 dbj|BAN15743.1| pyrabactin resistance [Dianthus caryophyllus] 73 7e-11 ref|XP_004234175.1| PREDICTED: abscisic acid receptor PYL8-like ... 72 9e-11 ref|XP_004234174.1| PREDICTED: abscisic acid receptor PYL8-like ... 72 9e-11 gb|AAT35532.1| CAPIP1 [Capsicum annuum] 72 9e-11 ref|XP_002509950.1| conserved hypothetical protein [Ricinus comm... 72 9e-11 ref|XP_002513580.1| conserved hypothetical protein [Ricinus comm... 72 9e-11 gb|ABF72432.1| PIP1 [Capsicum annuum] 72 9e-11 >ref|XP_006476396.1| PREDICTED: abscisic acid receptor PYL8-like [Citrus sinensis] Length = 197 Score = 78.6 bits (192), Expect = 1e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSEHLA+QDRTEPIDR+ Sbjct: 160 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPIDRI 197 >ref|XP_006439365.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] gi|557541627|gb|ESR52605.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] Length = 214 Score = 78.6 bits (192), Expect = 1e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSEHLA+QDRTEPIDR+ Sbjct: 177 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPIDRI 214 >ref|XP_006439364.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] gi|557541626|gb|ESR52604.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] Length = 197 Score = 78.6 bits (192), Expect = 1e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSEHLA+QDRTEPIDR+ Sbjct: 160 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPIDRI 197 >ref|XP_002321450.1| hypothetical protein POPTR_0015s02210g [Populus trichocarpa] gi|222868446|gb|EEF05577.1| hypothetical protein POPTR_0015s02210g [Populus trichocarpa] Length = 191 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPID 498 KDETCYFVEALIKCNLKSLADVSEHLA+QDRTEPID Sbjct: 154 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPID 189 >ref|XP_004145925.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus] gi|449524854|ref|XP_004169436.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus] Length = 195 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEP+DR+ Sbjct: 158 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEPLDRI 195 >gb|AEK99284.1| ABA receptor, partial [Cucumis sativus] Length = 107 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEP+DR+ Sbjct: 70 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEPLDRI 107 >ref|XP_002270037.2| PREDICTED: abscisic acid receptor PYL8 [Vitis vinifera] Length = 83 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEPIDR+ Sbjct: 46 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEPIDRM 83 >ref|XP_002304553.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa] gi|222841985|gb|EEE79532.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa] Length = 190 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEPIDR+ Sbjct: 153 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEPIDRM 190 >emb|CBI22536.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEPIDR+ Sbjct: 148 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEPIDRM 185 >emb|CBI34472.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEPIDR+ Sbjct: 148 KDETCYFVEALIKCNLKSLADVSERLAIQDRTEPIDRM 185 >gb|ESW12989.1| hypothetical protein PHAVU_008G158300g [Phaseolus vulgaris] Length = 145 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEPIDR+ Sbjct: 108 KDETCYFVEALIKCNLKSLADVSEGLAVQDRTEPIDRM 145 >ref|XP_003541499.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Glycine max] Length = 191 Score = 73.9 bits (180), Expect = 3e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE +A+QDRTEPIDR+ Sbjct: 154 KDETCYFVEALIKCNLKSLADVSEGIAVQDRTEPIDRI 191 >gb|EOY24998.1| Regulatory components of ABA receptor 3 [Theobroma cacao] Length = 193 Score = 73.2 bits (178), Expect = 5e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEPI+R+ Sbjct: 156 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEPIERM 193 >dbj|BAN15743.1| pyrabactin resistance [Dianthus caryophyllus] Length = 197 Score = 72.8 bits (177), Expect = 7e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV*IDV 480 KDETCYFVEALIKCNLKSLADVSE A++DRTEPIDR+ I++ Sbjct: 156 KDETCYFVEALIKCNLKSLADVSERSAVRDRTEPIDRMPIEI 197 >ref|XP_004234175.1| PREDICTED: abscisic acid receptor PYL8-like isoform 2 [Solanum lycopersicum] Length = 185 Score = 72.4 bits (176), Expect = 9e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALI CNLKSLADVSE LA+QDRTEPID+V Sbjct: 148 KDETCYFVEALINCNLKSLADVSERLAVQDRTEPIDQV 185 >ref|XP_004234174.1| PREDICTED: abscisic acid receptor PYL8-like isoform 1 [Solanum lycopersicum] Length = 207 Score = 72.4 bits (176), Expect = 9e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALI CNLKSLADVSE LA+QDRTEPID+V Sbjct: 170 KDETCYFVEALINCNLKSLADVSERLAVQDRTEPIDQV 207 >gb|AAT35532.1| CAPIP1 [Capsicum annuum] Length = 186 Score = 72.4 bits (176), Expect = 9e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALI CNLKSLADVSE LA+QDRTEPID+V Sbjct: 149 KDETCYFVEALINCNLKSLADVSERLAVQDRTEPIDQV 186 >ref|XP_002509950.1| conserved hypothetical protein [Ricinus communis] gi|223549849|gb|EEF51337.1| conserved hypothetical protein [Ricinus communis] Length = 196 Score = 72.4 bits (176), Expect = 9e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALIKCNL SLA+VSEHLA+ DRTEPIDR+ Sbjct: 159 KDETCYFVEALIKCNLTSLANVSEHLAVHDRTEPIDRI 196 >ref|XP_002513580.1| conserved hypothetical protein [Ricinus communis] gi|223547488|gb|EEF48983.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 72.4 bits (176), Expect = 9e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPID 498 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEPID Sbjct: 158 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEPID 193 >gb|ABF72432.1| PIP1 [Capsicum annuum] Length = 185 Score = 72.4 bits (176), Expect = 9e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 605 KDETCYFVEALIKCNLKSLADVSEHLAMQDRTEPIDRV 492 KDETCYFVEALI CNLKSLADVSE LA+QDRTEPID+V Sbjct: 148 KDETCYFVEALINCNLKSLADVSERLAVQDRTEPIDQV 185