BLASTX nr result
ID: Rehmannia22_contig00004307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00004307 (439 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC34532.1| hypothetical protein L484_019131 [Morus notabilis] 55 7e-06 >gb|EXC34532.1| hypothetical protein L484_019131 [Morus notabilis] Length = 232 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/59 (49%), Positives = 41/59 (69%) Frame = +3 Query: 21 STPSSRNKSSISGFGEPSKPPKRKRVDVHQNKSINHSAQDSGKGNSAVTSTGSLEHSQE 197 S+ SSR+KSS+S GEPS P + V ++S +HS Q+SG+ +SAVTS+GS E S + Sbjct: 165 SSHSSRHKSSLSDVGEPSTAPSKSHVP-EPSRSNDHSTQNSGRASSAVTSSGSFERSHQ 222