BLASTX nr result
ID: Rehmannia22_contig00003593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00003593 (654 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369778.1| hypothetical protein POPTR_0001s31360g [Popu... 61 3e-07 ref|XP_002300216.1| predicted protein [Populus trichocarpa] 61 3e-07 gb|EXB80382.1| hypothetical protein L484_010951 [Morus notabilis] 58 2e-06 >ref|XP_006369778.1| hypothetical protein POPTR_0001s31360g [Populus trichocarpa] gi|550348627|gb|ERP66347.1| hypothetical protein POPTR_0001s31360g [Populus trichocarpa] Length = 248 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 547 KLASEEVRLEIERQIEEARKKLFDDVEAQLKKEKEA 654 KL SEEV+LEIER+IEE RKKLFDDVEAQL KEKEA Sbjct: 117 KLNSEEVQLEIERRIEEGRKKLFDDVEAQLHKEKEA 152 >ref|XP_002300216.1| predicted protein [Populus trichocarpa] Length = 248 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 547 KLASEEVRLEIERQIEEARKKLFDDVEAQLKKEKEA 654 KL SEEV+LEIER+IEE RKKLFDDVEAQL KEKEA Sbjct: 117 KLNSEEVQLEIERRIEEGRKKLFDDVEAQLHKEKEA 152 >gb|EXB80382.1| hypothetical protein L484_010951 [Morus notabilis] Length = 265 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 547 KLASEEVRLEIERQIEEARKKLFDDVEAQLKKEKEA 654 ++ SEEV+LEIER+IEE RKKLFDDV AQL+KEKEA Sbjct: 135 RMRSEEVKLEIERRIEEGRKKLFDDVAAQLEKEKEA 170