BLASTX nr result
ID: Rehmannia22_contig00003447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00003447 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245736.1| PREDICTED: thylakoid lumenal protein At1g122... 56 4e-06 ref|XP_004245735.1| PREDICTED: thylakoid lumenal protein At1g122... 56 4e-06 >ref|XP_004245736.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 309 Score = 56.2 bits (134), Expect = 4e-06 Identities = 36/68 (52%), Positives = 44/68 (64%) Frame = -1 Query: 205 KMAMTSISLLPLKSINGISSTSIPDRTLNSLCIPSKPFSVTCQLETPNSKHETEPKNWKK 26 KMA+ SISLLP+KSIN ISS+SI + IP K + CQ+E NS E K WK Sbjct: 45 KMALNSISLLPIKSIN-ISSSSI---RYYKVFIPQKSSKIVCQVEKSNS--NIEIKKWKA 98 Query: 25 LVSTSLAA 2 +VST+LAA Sbjct: 99 IVSTALAA 106 >ref|XP_004245735.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like isoform 1 [Solanum lycopersicum] Length = 329 Score = 56.2 bits (134), Expect = 4e-06 Identities = 36/68 (52%), Positives = 44/68 (64%) Frame = -1 Query: 205 KMAMTSISLLPLKSINGISSTSIPDRTLNSLCIPSKPFSVTCQLETPNSKHETEPKNWKK 26 KMA+ SISLLP+KSIN ISS+SI + IP K + CQ+E NS E K WK Sbjct: 45 KMALNSISLLPIKSIN-ISSSSI---RYYKVFIPQKSSKIVCQVEKSNS--NIEIKKWKA 98 Query: 25 LVSTSLAA 2 +VST+LAA Sbjct: 99 IVSTALAA 106