BLASTX nr result
ID: Rehmannia22_contig00003176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00003176 (336 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006302865.1| hypothetical protein CARUB_v10020996mg, part... 101 9e-20 ref|XP_006298742.1| hypothetical protein CARUB_v10014842mg [Caps... 101 9e-20 ref|NP_566331.1| ubiquitin-conjugating enzyme 11 [Arabidopsis th... 101 9e-20 emb|CAA78716.1| ubiquitin conjugating enzyme [Arabidopsis thalia... 101 9e-20 gb|AFC01193.1| ubiquitin-conjugating enzyme [Ammopiptanthus mong... 101 9e-20 ref|XP_006401371.1| hypothetical protein EUTSA_v10014935mg [Eutr... 101 1e-19 ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Popu... 101 1e-19 ref|XP_002309194.2| hypothetical protein POPTR_0006s11070g, part... 101 1e-19 gb|EMT27803.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops ... 101 1e-19 gb|EMT16862.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops ... 101 1e-19 gb|EMS65000.1| Ubiquitin-conjugating enzyme E2-17 kDa [Triticum ... 101 1e-19 gb|AFY06649.1| ubiquitin conjugating enzyme, partial [Carica pap... 101 1e-19 ref|XP_004161475.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 101 1e-19 ref|XP_004143958.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 101 1e-19 ref|XP_003564489.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 101 1e-19 ref|XP_002265672.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 101 1e-19 gb|ACN39809.1| unknown [Picea sitchensis] 101 1e-19 ref|XP_002509917.1| ubiquitin-conjugating enzyme E2, putative [R... 101 1e-19 ref|XP_002303624.1| ubiquitin conjugating-like enzyme family pro... 101 1e-19 gb|ABK94185.1| unknown [Populus trichocarpa] gi|118484898|gb|ABK... 101 1e-19 >ref|XP_006302865.1| hypothetical protein CARUB_v10020996mg, partial [Capsella rubella] gi|482571575|gb|EOA35763.1| hypothetical protein CARUB_v10020996mg, partial [Capsella rubella] Length = 188 Score = 101 bits (252), Expect = 9e-20 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 141 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 188 >ref|XP_006298742.1| hypothetical protein CARUB_v10014842mg [Capsella rubella] gi|482567451|gb|EOA31640.1| hypothetical protein CARUB_v10014842mg [Capsella rubella] Length = 148 Score = 101 bits (252), Expect = 9e-20 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148 >ref|NP_566331.1| ubiquitin-conjugating enzyme 11 [Arabidopsis thaliana] gi|334185174|ref|NP_001189841.1| ubiquitin-conjugating enzyme 11 [Arabidopsis thaliana] gi|297829396|ref|XP_002882580.1| ubiquitin-conjugating enzyme 11 [Arabidopsis lyrata subsp. lyrata] gi|12643427|sp|P35134.2|UBC11_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 11; AltName: Full=Ubiquitin carrier protein 11; AltName: Full=Ubiquitin-conjugating enzyme E2-17 kDa 11; AltName: Full=Ubiquitin-protein ligase 11 gi|12322738|gb|AAG51362.1|AC012562_23 putative ubiquitin conjugating enzyme; 52410-53412 [Arabidopsis thaliana] gi|17380790|gb|AAL36225.1| putative E2, ubiquitin-conjugating enzyme UBC11 [Arabidopsis thaliana] gi|20259611|gb|AAM14162.1| putative ubiquitin conjugating enzyme 11 (UBC11) [Arabidopsis thaliana] gi|21554241|gb|AAM63316.1| E2, ubiquitin-conjugating enzyme UBC11 [Arabidopsis thaliana] gi|66354432|gb|AAY44851.1| ubiquitinating enzyme [Arabidopsis thaliana] gi|110736468|dbj|BAF00202.1| putative ubiquitin conjugating enzyme [Arabidopsis thaliana] gi|297328420|gb|EFH58839.1| ubiquitin-conjugating enzyme 11 [Arabidopsis lyrata subsp. lyrata] gi|332641143|gb|AEE74664.1| ubiquitin-conjugating enzyme 11 [Arabidopsis thaliana] gi|332641144|gb|AEE74665.1| ubiquitin-conjugating enzyme 11 [Arabidopsis thaliana] Length = 148 Score = 101 bits (252), Expect = 9e-20 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148 >emb|CAA78716.1| ubiquitin conjugating enzyme [Arabidopsis thaliana] gi|349215|gb|AAA32896.1| ubiquitin conjugating enzyme, partial [Arabidopsis thaliana] Length = 118 Score = 101 bits (252), Expect = 9e-20 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 71 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 118 >gb|AFC01193.1| ubiquitin-conjugating enzyme [Ammopiptanthus mongolicus] Length = 148 Score = 101 bits (252), Expect = 9e-20 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148 >ref|XP_006401371.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|567178671|ref|XP_006401372.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|567178674|ref|XP_006401373.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102461|gb|ESQ42824.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102462|gb|ESQ42825.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102463|gb|ESQ42826.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Populus trichocarpa] gi|550343111|gb|ERP63585.1| hypothetical protein POPTR_0003s13600g [Populus trichocarpa] Length = 107 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 60 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 107 >ref|XP_002309194.2| hypothetical protein POPTR_0006s11070g, partial [Populus trichocarpa] gi|550335954|gb|EEE92717.2| hypothetical protein POPTR_0006s11070g, partial [Populus trichocarpa] Length = 220 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 173 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 220 >gb|EMT27803.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops tauschii] Length = 162 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 115 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 162 >gb|EMT16862.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops tauschii] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >gb|EMS65000.1| Ubiquitin-conjugating enzyme E2-17 kDa [Triticum urartu] Length = 217 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 170 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 217 >gb|AFY06649.1| ubiquitin conjugating enzyme, partial [Carica papaya] Length = 124 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 77 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 124 >ref|XP_004161475.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Cucumis sativus] Length = 138 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 91 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 138 >ref|XP_004143958.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Cucumis sativus] Length = 160 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 113 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 160 >ref|XP_003564489.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Brachypodium distachyon] gi|357125621|ref|XP_003564490.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Brachypodium distachyon] gi|357125623|ref|XP_003564491.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Brachypodium distachyon] gi|357133250|ref|XP_003568239.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Brachypodium distachyon] gi|357133252|ref|XP_003568240.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Brachypodium distachyon] gi|357133254|ref|XP_003568241.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Brachypodium distachyon] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >ref|XP_002265672.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 1 [Vitis vinifera] gi|359478871|ref|XP_003632179.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 2 [Vitis vinifera] gi|297745749|emb|CBI15805.3| unnamed protein product [Vitis vinifera] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 148 >gb|ACN39809.1| unknown [Picea sitchensis] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >ref|XP_002509917.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] gi|223549816|gb|EEF51304.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] gi|386278586|gb|AFJ04525.1| ubiquitin-conjugating enzyme E2 [Vernicia fordii] gi|388505170|gb|AFK40651.1| unknown [Medicago truncatula] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 148 >ref|XP_002303624.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|118487400|gb|ABK95528.1| unknown [Populus trichocarpa] gi|222841056|gb|EEE78603.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|564587035|gb|AHB86964.1| ubiquitin conjugating enzyme 9 [Sedum alfredii] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >gb|ABK94185.1| unknown [Populus trichocarpa] gi|118484898|gb|ABK94315.1| unknown [Populus trichocarpa] Length = 148 Score = 101 bits (251), Expect = 1e-19 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 336 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEQTARSWTQKYAMG 193 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYE TARSWTQKYAMG Sbjct: 101 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 148