BLASTX nr result
ID: Rehmannia22_contig00002716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00002716 (427 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 1e-08 ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 1e-08 gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [... 63 3e-08 gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma... 63 3e-08 gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma... 63 3e-08 gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus pe... 62 8e-08 ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing... 61 2e-07 ref|XP_004241529.1| PREDICTED: BTB/POZ and TAZ domain-containing... 61 2e-07 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 61 2e-07 ref|XP_002322214.2| speckle-type POZ family protein [Populus tri... 60 3e-07 ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 7e-07 emb|CBI14900.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 7e-07 gb|EXB94438.1| BTB/POZ and TAZ domain-containing protein 1 [Moru... 59 9e-07 ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 9e-07 ref|XP_006404271.1| hypothetical protein EUTSA_v10010463mg [Eutr... 59 9e-07 ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 9e-07 ref|XP_006291273.1| hypothetical protein CARUB_v10017405mg [Caps... 58 1e-06 ref|XP_002877608.1| hypothetical protein ARALYDRAFT_323436 [Arab... 58 1e-06 emb|CAB41162.1| putative protein [Arabidopsis thaliana] 58 1e-06 >ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 345 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 RCKRMWQL +LHSSICDQPDECRVPLCR Sbjct: 258 RCKRMWQLLRLHSSICDQPDECRVPLCR 285 >ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum lycopersicum] Length = 345 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 RCKRMWQL +LHSSICDQPDECRVPLCR Sbjct: 258 RCKRMWQLLRLHSSICDQPDECRVPLCR 285 >gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 63.2 bits (152), Expect = 3e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSSICDQPD CRVPLCR + Sbjct: 167 RCKRMWQLLRLHSSICDQPDSCRVPLCRQFKL 198 >gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] Length = 334 Score = 63.2 bits (152), Expect = 3e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSSICDQPD CRVPLCR + Sbjct: 248 RCKRMWQLLRLHSSICDQPDSCRVPLCRQFKL 279 >gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 63.2 bits (152), Expect = 3e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSSICDQPD CRVPLCR + Sbjct: 268 RCKRMWQLLRLHSSICDQPDSCRVPLCRQFKL 299 >gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSS+CDQPD CRVPLCR + Sbjct: 328 RCKRMWQLLRLHSSMCDQPDSCRVPLCRQFKL 359 >ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 +CKRMWQL +LH+SICDQPD+CRVPLCR Sbjct: 265 QCKRMWQLLRLHASICDQPDDCRVPLCR 292 >ref|XP_004241529.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum lycopersicum] Length = 333 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 +CKRMWQL +LH+SICDQPD+CRVPLCR Sbjct: 249 QCKRMWQLLRLHASICDQPDDCRVPLCR 276 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LH+S+CDQPD CRVPLCR + Sbjct: 278 RCKRMWQLLRLHASMCDQPDSCRVPLCRQFKL 309 >ref|XP_002322214.2| speckle-type POZ family protein [Populus trichocarpa] gi|550322402|gb|EEF06341.2| speckle-type POZ family protein [Populus trichocarpa] Length = 360 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSSICDQ D CRVPLCR + Sbjct: 276 RCKRMWQLLRLHSSICDQTDSCRVPLCRQFKL 307 >ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 365 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSS+CDQ D CRVPLCR + Sbjct: 276 RCKRMWQLLRLHSSMCDQSDSCRVPLCRQFKL 307 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSSICDQ D CRVPLCR + Sbjct: 261 RCKRMWQLLRLHSSICDQTDLCRVPLCRQFKL 292 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSSICDQ D CRVPLCR + Sbjct: 265 RCKRMWQLLRLHSSICDQTDLCRVPLCRQFKL 296 >gb|EXB94438.1| BTB/POZ and TAZ domain-containing protein 1 [Morus notabilis] Length = 344 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQL +LHSSIC+Q D CRVPLCR + Sbjct: 272 RCKRMWQLLRLHSSICEQSDSCRVPLCRQFKL 303 >ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQ+ +LH+SICDQP++C+VPLCR + Sbjct: 264 RCKRMWQILRLHASICDQPNDCQVPLCRQFKL 295 >ref|XP_006404271.1| hypothetical protein EUTSA_v10010463mg [Eutrema salsugineum] gi|557105390|gb|ESQ45724.1| hypothetical protein EUTSA_v10010463mg [Eutrema salsugineum] Length = 372 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 RCKRM QLF+LHSSICDQP+ CRVPLCR Sbjct: 287 RCKRMLQLFRLHSSICDQPESCRVPLCR 314 >ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Solanum lycopersicum] Length = 349 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 332 RCKRMWQ+ +LH+SICDQP++C+VPLCR + Sbjct: 264 RCKRMWQILRLHASICDQPNDCQVPLCRQFKL 295 >ref|XP_006291273.1| hypothetical protein CARUB_v10017405mg [Capsella rubella] gi|482559980|gb|EOA24171.1| hypothetical protein CARUB_v10017405mg [Capsella rubella] Length = 394 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 RCKRM QLF+LHSS+CDQP+ CRVPLCR Sbjct: 307 RCKRMLQLFRLHSSVCDQPETCRVPLCR 334 >ref|XP_002877608.1| hypothetical protein ARALYDRAFT_323436 [Arabidopsis lyrata subsp. lyrata] gi|297323446|gb|EFH53867.1| hypothetical protein ARALYDRAFT_323436 [Arabidopsis lyrata subsp. lyrata] Length = 370 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 RCKRM QLF+LHS ICDQPD CRVPLCR Sbjct: 291 RCKRMLQLFRLHSLICDQPDSCRVPLCR 318 >emb|CAB41162.1| putative protein [Arabidopsis thaliana] Length = 367 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -1 Query: 427 RCKRMWQLFKLHSSICDQPDECRVPLCR 344 RCKRM QLF+LHS ICDQPD CRVPLCR Sbjct: 292 RCKRMLQLFRLHSLICDQPDSCRVPLCR 319