BLASTX nr result
ID: Rehmannia22_contig00002393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00002393 (710 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-co... 127 5e-27 ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-co... 123 5e-26 ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-co... 122 1e-25 ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-co... 119 7e-25 gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] 119 7e-25 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] 119 7e-25 gb|AAA33773.1| PVPR3 [Phaseolus vulgaris] gi|561006828|gb|ESW058... 119 1e-24 ref|XP_002314027.1| zinc finger family protein [Populus trichoca... 119 1e-24 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-... 118 2e-24 gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] 118 2e-24 gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] 117 3e-24 gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238... 117 3e-24 ref|XP_002513177.1| zinc finger protein, putative [Ricinus commu... 117 3e-24 ref|XP_002298442.1| zinc finger family protein [Populus trichoca... 117 3e-24 ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-co... 117 4e-24 ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-co... 117 5e-24 ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-co... 117 5e-24 ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-co... 116 6e-24 ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing st... 116 6e-24 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus... 115 1e-23 >ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 1 [Solanum lycopersicum] gi|88866527|gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] Length = 188 Score = 127 bits (318), Expect = 5e-27 Identities = 62/95 (65%), Positives = 66/95 (69%), Gaps = 8/95 (8%) Frame = -1 Query: 710 RSSPERSLNLPETSGDLKKXXXXXXXXXXXV--------RREVNRCSGCRRKVGLTGFRC 555 RSSP+R +L S DLKK +REVNRCSGCRRKVGLTGFRC Sbjct: 84 RSSPDRKSDLDRMSQDLKKVGDTMMVKEEDQLKASLPPAKREVNRCSGCRRKVGLTGFRC 143 Query: 554 RCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 RCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 144 RCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 178 >ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Solanum tuberosum] Length = 187 Score = 123 bits (309), Expect = 5e-26 Identities = 60/95 (63%), Positives = 65/95 (68%), Gaps = 8/95 (8%) Frame = -1 Query: 710 RSSPERSLNLPETSGDLKKXXXXXXXXXXXV--------RREVNRCSGCRRKVGLTGFRC 555 RS P+R +L S DLKK +REVNRCSGCRRKVGLTGFRC Sbjct: 83 RSLPDRKSDLDRMSQDLKKVGDWMMVKEEDQLKESLPPAKREVNRCSGCRRKVGLTGFRC 142 Query: 554 RCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 RCGELFC +HRYSDRHDC+YDYKT GREAI RENP Sbjct: 143 RCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP 177 >ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Vitis vinifera] Length = 172 Score = 122 bits (306), Expect = 1e-25 Identities = 59/87 (67%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = -1 Query: 704 SPERSLNLPETSGDLKKXXXXXXXXXXXVR--REVNRCSGCRRKVGLTGFRCRCGELFCA 531 SPER +L ETS D K + REVNRCSGCRRKVGLTGFRCRCG+LFCA Sbjct: 76 SPERMDSLAETSLDRTKDAASAAAVEEVGKVKREVNRCSGCRRKVGLTGFRCRCGDLFCA 135 Query: 530 DHRYSDRHDCSYDYKTVGREAIMRENP 450 +HRY+DRH+CSYDYKT GREAI RENP Sbjct: 136 EHRYTDRHECSYDYKTAGREAIARENP 162 >ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 2 [Solanum lycopersicum] Length = 159 Score = 119 bits (299), Expect = 7e-25 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 94 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 149 >gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] Length = 87 Score = 119 bits (299), Expect = 7e-25 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 22 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 77 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] Length = 88 Score = 119 bits (299), Expect = 7e-25 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 23 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 78 >gb|AAA33773.1| PVPR3 [Phaseolus vulgaris] gi|561006828|gb|ESW05822.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris] Length = 137 Score = 119 bits (297), Expect = 1e-24 Identities = 54/86 (62%), Positives = 63/86 (73%) Frame = -1 Query: 707 SSPERSLNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCAD 528 ++P S P+ S L+ +R VNRCSGCRR+VGLTGFRCRCG+LFCA+ Sbjct: 42 ATPATSSRSPKRSLPLEDAANADRTVASEPKRAVNRCSGCRRRVGLTGFRCRCGDLFCAE 101 Query: 527 HRYSDRHDCSYDYKTVGREAIMRENP 450 HRY+DRHDCSYDYKTVGREAI RENP Sbjct: 102 HRYTDRHDCSYDYKTVGREAIARENP 127 >ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa] gi|222850435|gb|EEE87982.1| zinc finger family protein [Populus trichocarpa] Length = 179 Score = 119 bits (297), Expect = 1e-24 Identities = 59/92 (64%), Positives = 66/92 (71%), Gaps = 5/92 (5%) Frame = -1 Query: 710 RSSPERSL-----NLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCG 546 RSS RSL PET+ D ++ ++EVNRCSGCRR+VGLTGFRCRCG Sbjct: 83 RSSISRSLVKDPQKSPETASDKERSCAYHVA-----KKEVNRCSGCRRRVGLTGFRCRCG 137 Query: 545 ELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 ELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 138 ELFCWEHRYSDRHDCSYDYKTAGREAIARENP 169 >gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Morus notabilis] Length = 172 Score = 118 bits (296), Expect = 2e-24 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +R VNRCSGCRRKVGLTGFRCRCGELFCA+HRYSDRHDCSYDYK+VGREAI RENP Sbjct: 107 KRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKSVGREAIARENP 162 >gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] Length = 147 Score = 118 bits (296), Expect = 2e-24 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDC+YDYKT GREAI RENP Sbjct: 88 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP 143 >gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] Length = 151 Score = 117 bits (294), Expect = 3e-24 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +REVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDC YDYKT GREAI RENP Sbjct: 92 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCXYDYKTAGREAIARENP 147 >gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238816903|gb|ACR56826.1| At3g12630-like protein [Solanum quitoense] Length = 150 Score = 117 bits (294), Expect = 3e-24 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +REV+RCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKT GREAI RENP Sbjct: 91 KREVSRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 146 >ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis] gi|223547675|gb|EEF49168.1| zinc finger protein, putative [Ricinus communis] Length = 140 Score = 117 bits (294), Expect = 3e-24 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +R+VNRCSGCRRKVGLTGFRCRCG+LFC +HRYSDRHDCSYDYKTVGREAI RENP Sbjct: 75 KRDVNRCSGCRRKVGLTGFRCRCGDLFCWEHRYSDRHDCSYDYKTVGREAIARENP 130 >ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa] gi|118486081|gb|ABK94884.1| unknown [Populus trichocarpa] gi|222845700|gb|EEE83247.1| zinc finger family protein [Populus trichocarpa] Length = 181 Score = 117 bits (294), Expect = 3e-24 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 ++EVNRCSGCRR+VGLTGFRCRCGELFC +HRYSDRHDCSYDYKTVGREAI RENP Sbjct: 116 KKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIARENP 171 >ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cicer arietinum] Length = 165 Score = 117 bits (293), Expect = 4e-24 Identities = 54/85 (63%), Positives = 63/85 (74%) Frame = -1 Query: 704 SPERSLNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADH 525 SP+RSL PE S ++ +R V+RCSGCRRKVGLTGFRCRCG+LFC++H Sbjct: 73 SPKRSL--PEESSEITDRNSSDQTTISEAKRVVSRCSGCRRKVGLTGFRCRCGDLFCSEH 130 Query: 524 RYSDRHDCSYDYKTVGREAIMRENP 450 RYSDRHDCS+DYK GREAI RENP Sbjct: 131 RYSDRHDCSFDYKAAGREAIARENP 155 >ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cicer arietinum] Length = 160 Score = 117 bits (292), Expect = 5e-24 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +R VNRCSGCRR+VGLTGFRCRCG+LFC++HRYSDRHDCSYDYKTVGREAI RENP Sbjct: 95 KRAVNRCSGCRRRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTVGREAIARENP 150 >ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] Length = 137 Score = 117 bits (292), Expect = 5e-24 Identities = 56/85 (65%), Positives = 61/85 (71%) Frame = -1 Query: 704 SPERSLNLPETSGDLKKXXXXXXXXXXXVRREVNRCSGCRRKVGLTGFRCRCGELFCADH 525 SP+RSL L E S +R VNRCSGCRR+VGLTGFRCRCG+LFCA+H Sbjct: 50 SPKRSLPLDEES-------QTDQTTSSEPKRAVNRCSGCRRRVGLTGFRCRCGDLFCAEH 102 Query: 524 RYSDRHDCSYDYKTVGREAIMRENP 450 RYSDRHDCSYDYK GREAI RENP Sbjct: 103 RYSDRHDCSYDYKAAGREAIARENP 127 >ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Glycine max] Length = 161 Score = 116 bits (291), Expect = 6e-24 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +R VNRCSGCRRKVGLTGFRCRCGELFCA+HRYSDRHDCSYDYK GREAI RENP Sbjct: 96 KRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP 151 >ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] gi|300510880|gb|ADK25058.1| AN1-like transcription factor [Glycine max] Length = 164 Score = 116 bits (291), Expect = 6e-24 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +R VNRCSGCRRKVGLTGFRCRCGELFCA+HRYSDRHDCSYDYK GREAI RENP Sbjct: 99 KRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP 154 >gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris] Length = 301 Score = 115 bits (288), Expect = 1e-23 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -1 Query: 617 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIMRENP 450 +R VNRCSGCRRKVGLTGFRCRCG+LFCA+HRYSDRHDCSYDYK GREAI RENP Sbjct: 236 KRVVNRCSGCRRKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP 291