BLASTX nr result
ID: Rehmannia22_contig00001421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00001421 (1069 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY12713.1| Serine/threonine kinases,protein kinases,ATP bind... 63 2e-07 emb|CBI33181.3| unnamed protein product [Vitis vinifera] 62 3e-07 ref|XP_006452101.1| hypothetical protein CICLE_v10010810mg, part... 62 5e-07 ref|XP_006475280.1| PREDICTED: uncharacterized protein LOC102629... 60 1e-06 ref|XP_004513947.1| PREDICTED: G-type lectin S-receptor-like ser... 59 3e-06 ref|XP_004295782.1| PREDICTED: G-type lectin S-receptor-like ser... 59 3e-06 ref|XP_006475249.1| PREDICTED: G-type lectin S-receptor-like ser... 59 3e-06 ref|XP_006475248.1| PREDICTED: G-type lectin S-receptor-like ser... 59 3e-06 ref|XP_006452089.1| hypothetical protein CICLE_v10008568mg [Citr... 59 3e-06 ref|XP_006370375.1| hypothetical protein POPTR_0001s42100g [Popu... 59 4e-06 ref|XP_002280938.2| PREDICTED: uncharacterized protein LOC100246... 59 4e-06 emb|CBI20427.3| unnamed protein product [Vitis vinifera] 59 4e-06 ref|XP_002330378.1| predicted protein [Populus trichocarpa] 59 4e-06 emb|CAN70177.1| hypothetical protein VITISV_000002 [Vitis vinifera] 59 4e-06 ref|XP_006475279.1| PREDICTED: G-type lectin S-receptor-like ser... 58 6e-06 ref|XP_006350372.1| PREDICTED: G-type lectin S-receptor-like ser... 58 6e-06 ref|XP_006452095.1| hypothetical protein CICLE_v10007596mg [Citr... 58 6e-06 gb|ESW21651.1| hypothetical protein PHAVU_005G088200g [Phaseolus... 58 7e-06 ref|XP_006452106.1| hypothetical protein CICLE_v10007528mg [Citr... 58 7e-06 ref|XP_006452105.1| hypothetical protein CICLE_v10007572mg [Citr... 58 7e-06 >gb|EOY12713.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate binding, putative [Theobroma cacao] Length = 865 Score = 63.2 bits (152), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 843 KIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 K H +DLELPLFDL+TIS ATNNFS TNKLGEGG+G Sbjct: 482 KTHKEDLELPLFDLATISCATNNFSTTNKLGEGGFG 517 >emb|CBI33181.3| unnamed protein product [Vitis vinifera] Length = 263 Score = 62.4 bits (150), Expect = 3e-07 Identities = 38/83 (45%), Positives = 48/83 (57%), Gaps = 4/83 (4%) Frame = +3 Query: 789 LVYSPKQNELLFVLVMIHKIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYGL----I 956 LVY+P Q+ I +DLELPLFDL TI ATNNFS+ NK+G+GG+GL I Sbjct: 186 LVYNPNQS-------FSRDIGEEDLELPLFDLVTIKVATNNFSLANKIGQGGFGLVYKVI 238 Query: 957 SFHNVCRHNLPFLR*ASWIFWRI 1025 S+H + N R W +W I Sbjct: 239 SYH-IFTGNCSMER-KKWAYWLI 259 >ref|XP_006452101.1| hypothetical protein CICLE_v10010810mg, partial [Citrus clementina] gi|557555327|gb|ESR65341.1| hypothetical protein CICLE_v10010810mg, partial [Citrus clementina] Length = 690 Score = 61.6 bits (148), Expect = 5e-07 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 6/66 (9%) Frame = +3 Query: 777 LRKSLVYSPKQNELLFVLVMI------HKIHNKDLELPLFDLSTISKATNNFSITNKLGE 938 ++ S+ K N+ L+ + + + N DLELPLF+L+TI+ AT+NFSI NKLGE Sbjct: 461 IKSSIKSFTKYNKFLYATITVCLFQDEEENRNMDLELPLFELATIANATDNFSINNKLGE 520 Query: 939 GGYGLI 956 GG+GL+ Sbjct: 521 GGFGLV 526 >ref|XP_006475280.1| PREDICTED: uncharacterized protein LOC102629172 [Citrus sinensis] Length = 1625 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 843 KIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 ++ N DLELPLF+L+TI+ ATNNFSI NKLGEGG+G Sbjct: 472 QVQNMDLELPLFELATIANATNNFSINNKLGEGGFG 507 Score = 57.4 bits (137), Expect = 1e-05 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 852 NKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 N+DLELPLF+L+TI+ AT+NFSI NKLGEGG+G Sbjct: 1288 NEDLELPLFELATIANATDNFSINNKLGEGGFG 1320 >ref|XP_004513947.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like isoform X1 [Cicer arietinum] Length = 821 Score = 59.3 bits (142), Expect = 3e-06 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = +3 Query: 756 AI*FVSLLRKSLVYSPKQNELLFVLVMIHKIH--NKDLELPLFDLSTISKATNNFSITNK 929 +I V LL + +Y K ++++ K+ N+D ELP+FD +TI KATNNFSI NK Sbjct: 450 SIVLVMLLGFTYIYITKAKHKDKIIMLGEKVEDKNEDYELPIFDQATILKATNNFSIDNK 509 Query: 930 LGEGGYG 950 LGEGG+G Sbjct: 510 LGEGGFG 516 >ref|XP_004295782.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Fragaria vesca subsp. vesca] Length = 1396 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 837 IHKIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 I + +DLELPLFDLSTI ATNNFSI NKLGEGG+G Sbjct: 472 IEEQKEEDLELPLFDLSTIETATNNFSINNKLGEGGFG 509 >ref|XP_006475249.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like isoform X2 [Citrus sinensis] Length = 800 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 852 NKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 N DLELPLF+L+TIS ATNNFSI NKLGEGG+G Sbjct: 472 NIDLELPLFELATISNATNNFSINNKLGEGGFG 504 >ref|XP_006475248.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like isoform X1 [Citrus sinensis] Length = 809 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 852 NKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 N DLELPLF+L+TIS ATNNFSI NKLGEGG+G Sbjct: 472 NIDLELPLFELATISNATNNFSINNKLGEGGFG 504 >ref|XP_006452089.1| hypothetical protein CICLE_v10008568mg [Citrus clementina] gi|557555315|gb|ESR65329.1| hypothetical protein CICLE_v10008568mg [Citrus clementina] Length = 391 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 852 NKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 N DLELPLF+L+TIS ATNNFSI NKLGEGG+G Sbjct: 54 NIDLELPLFELATISNATNNFSINNKLGEGGFG 86 >ref|XP_006370375.1| hypothetical protein POPTR_0001s42100g [Populus trichocarpa] gi|550349554|gb|ERP66944.1| hypothetical protein POPTR_0001s42100g [Populus trichocarpa] Length = 771 Score = 58.5 bits (140), Expect = 4e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +3 Query: 846 IHNKDLELPLFDLSTISKATNNFSITNKLGEGGYGLI 956 +H +DLELP+FDL T++ ATNNFS+ NKLGEGG+G + Sbjct: 432 MHKEDLELPMFDLGTLACATNNFSVENKLGEGGFGSV 468 >ref|XP_002280938.2| PREDICTED: uncharacterized protein LOC100246941 [Vitis vinifera] Length = 1603 Score = 58.5 bits (140), Expect = 4e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 855 KDLELPLFDLSTISKATNNFSITNKLGEGGYGLI 956 +D+ELPLFD +T+SKATN+FSI NKLGEGG+GL+ Sbjct: 481 EDVELPLFDFATVSKATNHFSIHNKLGEGGFGLV 514 >emb|CBI20427.3| unnamed protein product [Vitis vinifera] Length = 2646 Score = 58.5 bits (140), Expect = 4e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 855 KDLELPLFDLSTISKATNNFSITNKLGEGGYGLI 956 +D+ELPLFD +T+SKATN+FSI NKLGEGG+GL+ Sbjct: 1539 EDVELPLFDFATVSKATNHFSIHNKLGEGGFGLV 1572 >ref|XP_002330378.1| predicted protein [Populus trichocarpa] Length = 771 Score = 58.5 bits (140), Expect = 4e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +3 Query: 846 IHNKDLELPLFDLSTISKATNNFSITNKLGEGGYGLI 956 +H +DLELP+FDL T++ ATNNFS+ NKLGEGG+G + Sbjct: 432 MHKEDLELPMFDLGTLACATNNFSVENKLGEGGFGSV 468 >emb|CAN70177.1| hypothetical protein VITISV_000002 [Vitis vinifera] Length = 1115 Score = 58.5 bits (140), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 855 KDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 KDLELPLFDL+TI ATNNFSI NKLGEGG+G Sbjct: 439 KDLELPLFDLATILNATNNFSIENKLGEGGFG 470 >ref|XP_006475279.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Citrus sinensis] Length = 777 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 843 KIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 ++ N DLELPLF+L+TI+ AT+NFSI NKLGEGG+G Sbjct: 472 QVQNMDLELPLFELATIANATSNFSINNKLGEGGFG 507 >ref|XP_006350372.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Solanum tuberosum] Length = 834 Score = 58.2 bits (139), Expect = 6e-06 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = +3 Query: 795 YSPKQNELLFVLVMIHKIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 +S +E+L+ I+K N DL+LPLFD +TI +ATNN S++NKLGEGG+G Sbjct: 482 FSEGSSEMLY----INKSKNDDLDLPLFDFATILEATNNLSLSNKLGEGGFG 529 >ref|XP_006452095.1| hypothetical protein CICLE_v10007596mg [Citrus clementina] gi|557555321|gb|ESR65335.1| hypothetical protein CICLE_v10007596mg [Citrus clementina] Length = 721 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 843 KIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 ++ N DLELPLF+L+TI+ AT+NFSI NKLGEGG+G Sbjct: 381 QVQNMDLELPLFELATIANATDNFSINNKLGEGGFG 416 >gb|ESW21651.1| hypothetical protein PHAVU_005G088200g [Phaseolus vulgaris] Length = 817 Score = 57.8 bits (138), Expect = 7e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +3 Query: 837 IHKIHNKDLELPLFDLSTISKATNNFSITNKLGEGGYGLI 956 I++ +KDLELP+F+LSTI+ ATNNFS NKLGEGG+G + Sbjct: 478 INEHESKDLELPMFELSTITSATNNFSPDNKLGEGGFGSV 517 >ref|XP_006452106.1| hypothetical protein CICLE_v10007528mg [Citrus clementina] gi|557555332|gb|ESR65346.1| hypothetical protein CICLE_v10007528mg [Citrus clementina] Length = 769 Score = 57.8 bits (138), Expect = 7e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 846 IHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 + N DLELPLF+L+TI+ AT+NFSI NKLGEGG+G Sbjct: 428 VQNMDLELPLFELATIANATDNFSINNKLGEGGFG 462 >ref|XP_006452105.1| hypothetical protein CICLE_v10007572mg [Citrus clementina] gi|557555331|gb|ESR65345.1| hypothetical protein CICLE_v10007572mg [Citrus clementina] Length = 740 Score = 57.8 bits (138), Expect = 7e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 846 IHNKDLELPLFDLSTISKATNNFSITNKLGEGGYG 950 + N DLELPLF+L+TI+ AT+NFSI NKLGEGG+G Sbjct: 401 VQNMDLELPLFELATIANATDNFSINNKLGEGGFG 435