BLASTX nr result
ID: Rehmannia22_contig00000622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00000622 (388 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60934.1| hypothetical protein M569_13865, partial [Genlise... 61 1e-07 gb|AEC10983.1| phosphatidylglycerol/phosphatidylinositol transfe... 59 7e-07 ref|XP_004303422.1| PREDICTED: phosphatidylglycerol/phosphatidyl... 57 3e-06 >gb|EPS60934.1| hypothetical protein M569_13865, partial [Genlisea aurea] Length = 91 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 387 TPPGSYTLKMTMVDANKKQLTCITFDFSIGFFAEEN 280 TPPG+Y LKM MVD KQLTCITFDFSIG F+EE+ Sbjct: 56 TPPGNYNLKMKMVDEKNKQLTCITFDFSIGLFSEED 91 >gb|AEC10983.1| phosphatidylglycerol/phosphatidylinositol transfer protein precursor [Camellia sinensis] Length = 156 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 387 TPPGSYTLKMTMVDANKKQLTCITFDFSIGFFAEENLA 274 TPPG+YTL M M D NK QLTCI FDFSIGFF + +A Sbjct: 117 TPPGTYTLTMKMEDGNKNQLTCINFDFSIGFFVSDAVA 154 >ref|XP_004303422.1| PREDICTED: phosphatidylglycerol/phosphatidylinositol transfer protein-like [Fragaria vesca subsp. vesca] Length = 154 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 387 TPPGSYTLKMTMVDANKKQLTCITFDFSIGFFA 289 TPPGSY+LKM M DANK++LTCI FDF IGF A Sbjct: 117 TPPGSYSLKMKMYDANKQELTCIAFDFDIGFAA 149