BLASTX nr result
ID: Rehmannia22_contig00000595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00000595 (664 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV64742.1| glycine-rich protein 1 [Boea hygrometrica] 56 8e-06 >gb|ABV64742.1| glycine-rich protein 1 [Boea hygrometrica] Length = 131 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -3 Query: 647 MGSKVIVFLGLFLATILLISSEAAARELAETSNTVDTSNDAEKT 516 MG K IVFLGLF+A +LLISSE ARELAET++ +D + E T Sbjct: 1 MGYKAIVFLGLFVAIVLLISSEVGARELAETTDAIDAEKETEAT 44