BLASTX nr result
ID: Rehmannia22_contig00000522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00000522 (569 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61380.1| hypothetical protein M569_13417 [Genlisea aurea] 67 2e-09 gb|EPS67410.1| hypothetical protein M569_07367, partial [Genlise... 63 5e-08 >gb|EPS61380.1| hypothetical protein M569_13417 [Genlisea aurea] Length = 246 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = -2 Query: 565 RENYFNYXXXXXXXXGNRRFQPQGMSDTRSLENGKYFYDVNTEMYSSNHPYESLR 401 RENYF FQPQGMSDTR+ +NGKYFYDVN E +SS+HPYE+L+ Sbjct: 162 RENYFPAAG---------EFQPQGMSDTRAFQNGKYFYDVNAERFSSSHPYETLK 207 >gb|EPS67410.1| hypothetical protein M569_07367, partial [Genlisea aurea] Length = 64 Score = 63.2 bits (152), Expect = 5e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 505 QPQGMSDTRSLENGKYFYDVNTEMYSSNHPYESLR 401 +PQGMSDTRS +NGKYFYDVN E +SS+HPYE+L+ Sbjct: 14 RPQGMSDTRSFDNGKYFYDVNEERFSSSHPYEALK 48