BLASTX nr result
ID: Rehmannia22_contig00000092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00000092 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006387741.1| hypothetical protein POPTR_0626s00200g [Popu... 55 7e-06 >ref|XP_006387741.1| hypothetical protein POPTR_0626s00200g [Populus trichocarpa] gi|550308313|gb|ERP46655.1| hypothetical protein POPTR_0626s00200g [Populus trichocarpa] Length = 84 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -2 Query: 238 WGI-SKLFGSSEPE--KMMKAPGRDYYMPRKDFEESPSDYFRNLR 113 WGI S LF S EP+ K MKAPGRD+ MPR DFE P YF++LR Sbjct: 39 WGIGSALFSSPEPDAGKTMKAPGRDHRMPRADFERDPKGYFKDLR 83