BLASTX nr result
ID: Rauwolfia21_contig00055101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00055101 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY34681.1| Uncharacterized protein TCM_042273 [Theobroma cacao] 60 4e-07 gb|EXC19552.1| hypothetical protein L484_010683 [Morus notabilis] 58 1e-06 ref|XP_002518272.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >gb|EOY34681.1| Uncharacterized protein TCM_042273 [Theobroma cacao] Length = 438 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/58 (53%), Positives = 38/58 (65%) Frame = +3 Query: 138 ECTAAKPSKTPSNIFEIDSEFAKVCKLRSIGVFPSENQYLTGCQNAAISEESSSDATE 311 E T KPSK SNI E+ S+FA+VCKLRS GVF +EN T NA + E+SS + E Sbjct: 2 EYTTTKPSKPSSNISELVSKFARVCKLRSTGVFSAENMLNTSNINAPLGEDSSDNTEE 59 >gb|EXC19552.1| hypothetical protein L484_010683 [Morus notabilis] Length = 439 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/58 (56%), Positives = 37/58 (63%) Frame = +3 Query: 138 ECTAAKPSKTPSNIFEIDSEFAKVCKLRSIGVFPSENQYLTGCQNAAISEESSSDATE 311 E KP K+ SNI EI S+FAKVCKLRS GVFPSE+ N A+ EESS TE Sbjct: 2 EIVTTKPFKSSSNISEIVSKFAKVCKLRSTGVFPSES-------NGAVVEESSDATTE 52 >ref|XP_002518272.1| conserved hypothetical protein [Ricinus communis] gi|223542492|gb|EEF44032.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 8/64 (12%) Frame = +3 Query: 144 TAAKPSKTPSNIFEIDSEFAKVCKLRSIGVFPSEN--------QYLTGCQNAAISEESSS 299 T+ KPSK NI E+ S+FAK+CKLRSIGVF +EN Q+ N E SS Sbjct: 5 TSIKPSKPSPNISEMVSKFAKICKLRSIGVFSNENPNQQHHQYQHCLNNNNVPSVSEDSS 64 Query: 300 DATE 311 DATE Sbjct: 65 DATE 68