BLASTX nr result
ID: Rauwolfia21_contig00053042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00053042 (585 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360680.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006426143.1| hypothetical protein CICLE_v10025041mg [Citr... 57 5e-06 gb|EPS71548.1| hypothetical protein M569_03209, partial [Genlise... 56 6e-06 ref|XP_004240287.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_006360680.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Solanum tuberosum] Length = 723 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 578 VNLSNICANVGNWEESAYVRELMKKHGIMKQPGSSWIGS 462 V LSNI A+ NWE+SA VR+LM K G++KQPGSSWIGS Sbjct: 685 VLLSNIYASAENWEDSANVRKLMNKCGVLKQPGSSWIGS 723 >ref|XP_006426143.1| hypothetical protein CICLE_v10025041mg [Citrus clementina] gi|557528133|gb|ESR39383.1| hypothetical protein CICLE_v10025041mg [Citrus clementina] Length = 696 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 578 VNLSNICANVGNWEESAYVRELMKKHGIMKQPGSSWIGS 462 V LSNI A G WEE+A +REL+K+ G+MKQPG SWIGS Sbjct: 658 VLLSNIYAAAGLWEEAANIRELLKRTGVMKQPGCSWIGS 696 >gb|EPS71548.1| hypothetical protein M569_03209, partial [Genlisea aurea] Length = 720 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 578 VNLSNICANVGNWEESAYVRELMKKHGIMKQPGSSWIGS 462 V LSN+ AN G WE SA +RE MKK+GIMK+PG+SWI S Sbjct: 682 VLLSNLYANAGEWEGSAILREAMKKNGIMKRPGNSWITS 720 >ref|XP_004240287.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Solanum lycopersicum] Length = 720 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 578 VNLSNICANVGNWEESAYVRELMKKHGIMKQPGSSWIGS 462 V LSNI A+ NWE SA VR+LM K G++KQPGSSWIGS Sbjct: 682 VLLSNIYASAENWEGSANVRKLMNKCGVLKQPGSSWIGS 720