BLASTX nr result
ID: Rauwolfia21_contig00052382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00052382 (519 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 77 3e-12 pir||S46947 ribosomal protein L2 - evening primrose mitochondrio... 77 3e-12 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] 75 7e-12 ref|XP_004253315.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 75 7e-12 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 75 7e-12 gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tubero... 75 7e-12 ref|YP_008802489.1| ribosomal protein L2 (mitochondrion) [Asclep... 75 9e-12 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 74 2e-11 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 72 8e-11 gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium h... 71 2e-10 gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palm... 71 2e-10 ref|XP_004168533.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 69 7e-10 ref|XP_004152990.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 69 7e-10 gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] 69 7e-10 ref|YP_004849339.1| ribosomal protein L2 [Cucumis sativus] gi|32... 69 7e-10 gb|AAL48208.1|AF387187_1 ribosomal protein L2 [Gossypium arboreum] 68 1e-09 ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259... 67 3e-09 gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sa... 66 4e-09 ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|375911... 66 4e-09 ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochond... 66 4e-09 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQET GLVGA++HNESKPK DQGSLPAKPIGEGTKDG Sbjct: 249 SFRRQETDGLVGAAEHNESKPKTDQGSLPAKPIGEGTKDG 288 >pir||S46947 ribosomal protein L2 - evening primrose mitochondrion gi|516394|emb|CAA56451.1| 70s mitochondrial ribosomal protein L2 [Oenothera berteroana] Length = 332 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQET GLVGA++HNESKPK DQGSLPAKPIGEGTKDG Sbjct: 246 SFRRQETDGLVGAAEHNESKPKTDQGSLPAKPIGEGTKDG 285 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] Length = 331 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVGAS+ NESKPK DQGSLPAKPIGEG KDG Sbjct: 245 SFRRQETLGLVGASERNESKPKTDQGSLPAKPIGEGLKDG 284 >ref|XP_004253315.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like, partial [Solanum lycopersicum] Length = 366 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVGAS+ NESKPK DQGSLPAKPIGEG KDG Sbjct: 235 SFRRQETLGLVGASERNESKPKTDQGSLPAKPIGEGLKDG 274 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVGAS+ NESKPK DQGSLPAKPIGEG KDG Sbjct: 245 SFRRQETLGLVGASERNESKPKTDQGSLPAKPIGEGLKDG 284 >gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tuberosum] Length = 296 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVGAS+ NESKPK DQGSLPAKPIGEG KDG Sbjct: 247 SFRRQETLGLVGASERNESKPKTDQGSLPAKPIGEGLKDG 286 >ref|YP_008802489.1| ribosomal protein L2 (mitochondrion) [Asclepias syriaca] gi|556562328|gb|AGZ63024.1| ribosomal protein L2 (mitochondrion) [Asclepias syriaca] Length = 299 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQET GLVGAS+HNESKPKM QGSLP KPIGEGTKDG Sbjct: 230 SFRRQETDGLVGASEHNESKPKMYQGSLPTKPIGEGTKDG 269 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVG ++HNESKP+ DQGSLPAKPIGEG KDG Sbjct: 246 SFRRQETLGLVGGAEHNESKPETDQGSLPAKPIGEGPKDG 285 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKD 122 SFRRQETLGLVGA++HNESKPK DQGSLPAKPIGE KD Sbjct: 249 SFRRQETLGLVGAAEHNESKPKTDQGSLPAKPIGERPKD 287 >gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKD 122 SFRRQ+TLGLVGA++HNESKPK DQGSLPAKPIGE KD Sbjct: 248 SFRRQDTLGLVGAAEHNESKPKTDQGSLPAKPIGERPKD 286 >gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palmer 679] Length = 228 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTK 119 SFRRQETLGLVGA++HNESKPK +QGSLPAKPIGEG K Sbjct: 191 SFRRQETLGLVGAAEHNESKPKTNQGSLPAKPIGEGPK 228 >ref|XP_004168533.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like [Cucumis sativus] Length = 455 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVG ++H ESK + DQGSLPAKPIGEG KDG Sbjct: 255 SFRRQETLGLVGGAEHKESKAERDQGSLPAKPIGEGPKDG 294 >ref|XP_004152990.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like [Cucumis sativus] Length = 386 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVG ++H ESK + DQGSLPAKPIGEG KDG Sbjct: 255 SFRRQETLGLVGGAEHKESKAERDQGSLPAKPIGEGPKDG 294 >gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] Length = 354 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVG ++H ESK + DQGSLPAKPIGEG KDG Sbjct: 255 SFRRQETLGLVGGAEHKESKAERDQGSLPAKPIGEGPKDG 294 >ref|YP_004849339.1| ribosomal protein L2 [Cucumis sativus] gi|325305597|gb|ADZ10766.1| ribosomal protein L2 [Cucumis sativus] Length = 341 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQETLGLVG ++H ESK + DQGSLPAKPIGEG KDG Sbjct: 255 SFRRQETLGLVGGAEHKESKAERDQGSLPAKPIGEGPKDG 294 >gb|AAL48208.1|AF387187_1 ribosomal protein L2 [Gossypium arboreum] Length = 270 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGE 110 SFRRQ+TLGLVGA++HNESKPK DQGSLPAKPIGE Sbjct: 234 SFRRQDTLGLVGAAEHNESKPKTDQGSLPAKPIGE 268 >ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259156826|gb|ACV96687.1| ribosomal protein L2 [Cucurbita pepo] Length = 332 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTKDG 125 SFRRQET GLVG ++HNESKP+ D SLPAKPIGEG KDG Sbjct: 246 SFRRQETDGLVGGAEHNESKPETDPASLPAKPIGEGPKDG 285 >gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTK 119 SFRRQ+TLGLVGA+ HN+SKPK DQGSLPAKPIGE K Sbjct: 247 SFRRQDTLGLVGAAGHNKSKPKTDQGSLPAKPIGERAK 284 >ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|37591104|dbj|BAC98906.1| ribosomal protein L2 [Brassica napus] Length = 349 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTK 119 SFRRQ+TLGLVGA+ HN+SKPK DQGSLPAKPIGE K Sbjct: 247 SFRRQDTLGLVGAAGHNKSKPKTDQGSLPAKPIGERAK 284 >ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278283|dbj|BAM36207.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278329|dbj|BAM36252.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|443298136|gb|AGC81680.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 6 SFRRQETLGLVGASKHNESKPKMDQGSLPAKPIGEGTK 119 SFRRQ+TLGLVGA+ HN+SKPK DQGSLPAKPIGE K Sbjct: 247 SFRRQDTLGLVGAAGHNKSKPKTDQGSLPAKPIGERAK 284