BLASTX nr result
ID: Rauwolfia21_contig00052241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00052241 (428 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ25187.1| hypothetical protein PRUPE_ppa014754mg [Prunus pe... 55 7e-06 >gb|EMJ25187.1| hypothetical protein PRUPE_ppa014754mg [Prunus persica] Length = 91 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = +3 Query: 3 ITSIGPPXXXXXXXXXXAVPSLPKTCQRCDVWYVINEDYYRHCN 134 + SIGPP VP PKTCQRCDVWYVI ED Y +C+ Sbjct: 46 VVSIGPPQSEKKDEKKDLVPYPPKTCQRCDVWYVIAEDGYNYCS 89