BLASTX nr result
ID: Rauwolfia21_contig00052238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00052238 (262 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC34716.1| Peptide chain release factor 1 [Morus notabilis] 59 9e-07 gb|AFK34285.1| unknown [Lotus japonicus] 59 9e-07 ref|XP_002269884.1| PREDICTED: peptide chain release factor 1 [V... 59 9e-07 gb|EPS73108.1| hypothetical protein M569_01644, partial [Genlise... 57 3e-06 ref|XP_006663089.1| PREDICTED: peptide chain release factor 1-li... 56 4e-06 ref|XP_006855485.1| hypothetical protein AMTR_s00057p00193080 [A... 56 4e-06 gb|ADV56693.1| peptide chain release factor [Phaseolus vulgaris] 56 4e-06 ref|XP_002520666.1| peptide chain release factor, putative [Rici... 56 4e-06 ref|XP_004979882.1| PREDICTED: peptide chain release factor 1-li... 56 6e-06 ref|XP_006479892.1| PREDICTED: peptide chain release factor 1-li... 55 8e-06 ref|XP_006444254.1| hypothetical protein CICLE_v10023263mg [Citr... 55 8e-06 gb|AFW60225.1| hypothetical protein ZEAMMB73_878070 [Zea mays] 55 8e-06 gb|AFW60222.1| hypothetical protein ZEAMMB73_878070 [Zea mays] 55 8e-06 ref|XP_003553645.1| PREDICTED: peptide chain release factor 1-li... 55 8e-06 ref|XP_003521543.1| PREDICTED: peptide chain release factor 1-li... 55 8e-06 gb|ACU20952.1| unknown [Glycine max] 55 8e-06 gb|ACF86687.1| unknown [Zea mays] gi|195648693|gb|ACG43814.1| hy... 55 8e-06 >gb|EXC34716.1| Peptide chain release factor 1 [Morus notabilis] Length = 413 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFLDGDIE+AVQ Sbjct: 363 DNRVTDHRLKMNFELTSFLDGDIENAVQ 390 >gb|AFK34285.1| unknown [Lotus japonicus] Length = 200 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFLDGDIE+AVQ Sbjct: 150 DNRVTDHRLKMNFELTSFLDGDIENAVQ 177 >ref|XP_002269884.1| PREDICTED: peptide chain release factor 1 [Vitis vinifera] gi|296086617|emb|CBI32252.3| unnamed protein product [Vitis vinifera] Length = 411 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFLDGDIE+AVQ Sbjct: 361 DNRVTDHRLKMNFELTSFLDGDIETAVQ 388 >gb|EPS73108.1| hypothetical protein M569_01644, partial [Genlisea aurea] Length = 412 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFLDG+IE+AVQ Sbjct: 364 DNRVTDHRLKMNFELTSFLDGNIETAVQ 391 >ref|XP_006663089.1| PREDICTED: peptide chain release factor 1-like, mitochondrial-like [Oryza brachyantha] Length = 371 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFL GDIESAVQ Sbjct: 318 DNRVTDHRLKMNFELTSFLMGDIESAVQ 345 >ref|XP_006855485.1| hypothetical protein AMTR_s00057p00193080 [Amborella trichopoda] gi|548859251|gb|ERN16952.1| hypothetical protein AMTR_s00057p00193080 [Amborella trichopoda] Length = 412 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFL GDIE+AVQ Sbjct: 362 DNRVTDHRLKMNFELTSFLSGDIETAVQ 389 >gb|ADV56693.1| peptide chain release factor [Phaseolus vulgaris] Length = 498 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQVN 171 DNRVTDHRLK N+ELTSFLDGDIE AVQ++ Sbjct: 433 DNRVTDHRLKTNYELTSFLDGDIEDAVQIS 462 >ref|XP_002520666.1| peptide chain release factor, putative [Ricinus communis] gi|223540051|gb|EEF41628.1| peptide chain release factor, putative [Ricinus communis] Length = 370 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFL GDIE+AVQ Sbjct: 320 DNRVTDHRLKMNFELTSFLQGDIENAVQ 347 >ref|XP_004979882.1| PREDICTED: peptide chain release factor 1-like, mitochondrial-like [Setaria italica] Length = 413 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFL GDIESAVQ Sbjct: 363 DNRVTDHRLKMNFELTSFLLGDIESAVQ 390 >ref|XP_006479892.1| PREDICTED: peptide chain release factor 1-like, mitochondrial-like [Citrus sinensis] Length = 416 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFLDG+I++AVQ Sbjct: 366 DNRVTDHRLKMNFELTSFLDGNIDNAVQ 393 >ref|XP_006444254.1| hypothetical protein CICLE_v10023263mg [Citrus clementina] gi|557546516|gb|ESR57494.1| hypothetical protein CICLE_v10023263mg [Citrus clementina] Length = 416 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFLDG+I++AVQ Sbjct: 366 DNRVTDHRLKMNFELTSFLDGNIDNAVQ 393 >gb|AFW60225.1| hypothetical protein ZEAMMB73_878070 [Zea mays] Length = 412 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFL GDIESA+Q Sbjct: 362 DNRVTDHRLKMNFELTSFLLGDIESAIQ 389 >gb|AFW60222.1| hypothetical protein ZEAMMB73_878070 [Zea mays] Length = 214 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFL GDIESA+Q Sbjct: 164 DNRVTDHRLKMNFELTSFLLGDIESAIQ 191 >ref|XP_003553645.1| PREDICTED: peptide chain release factor 1-like, mitochondrial-like isoform X1 [Glycine max] Length = 428 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLK+N+ELTSFLDGDIE AVQ Sbjct: 378 DNRVTDHRLKINYELTSFLDGDIEDAVQ 405 >ref|XP_003521543.1| PREDICTED: peptide chain release factor 1-like [Glycine max] Length = 429 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLK+N+ELTSFLDGDIE AVQ Sbjct: 379 DNRVTDHRLKINYELTSFLDGDIEDAVQ 406 >gb|ACU20952.1| unknown [Glycine max] Length = 230 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLK+N+ELTSFLDGDIE AVQ Sbjct: 180 DNRVTDHRLKINYELTSFLDGDIEDAVQ 207 >gb|ACF86687.1| unknown [Zea mays] gi|195648693|gb|ACG43814.1| hypothetical protein [Zea mays] gi|413920291|gb|AFW60223.1| hypothetical protein ZEAMMB73_878070 [Zea mays] gi|413920292|gb|AFW60224.1| hypothetical protein ZEAMMB73_878070 [Zea mays] Length = 230 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 260 DNRVTDHRLKMNFELTSFLDGDIESAVQ 177 DNRVTDHRLKMNFELTSFL GDIESA+Q Sbjct: 180 DNRVTDHRLKMNFELTSFLLGDIESAIQ 207