BLASTX nr result
ID: Rauwolfia21_contig00051465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00051465 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342132.1| PREDICTED: cyclin-B2-4-like [Solanum tuberosum] 59 9e-07 ref|XP_004238428.1| PREDICTED: cyclin-B2-4-like [Solanum lycoper... 57 2e-06 gb|AEO86797.1| cyclin [Camellia sinensis] 57 2e-06 >ref|XP_006342132.1| PREDICTED: cyclin-B2-4-like [Solanum tuberosum] Length = 441 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = +2 Query: 227 MEGADENYAVVIRPSNLQGEMRAG-GEKLNAGMGAHQRRALSTINRN 364 M G+DENY VIRPSNLQG +R G G K+N G+G + RRALSTINRN Sbjct: 1 MAGSDENYPGVIRPSNLQGGLRPGVGGKVNGGLGQN-RRALSTINRN 46 >ref|XP_004238428.1| PREDICTED: cyclin-B2-4-like [Solanum lycopersicum] Length = 440 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 227 MEGADENYAVVIRPSNLQGEMRAG-GEKLNAGMGAHQRRALSTINRN 364 M G+DENY VIRPSNLQG +R G G K+N G+G RRALSTIN+N Sbjct: 1 MAGSDENYPGVIRPSNLQGGLRPGVGGKVNGGLG-QNRRALSTINKN 46 >gb|AEO86797.1| cyclin [Camellia sinensis] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 227 MEGADENYAVVIRPSNLQGEMRAGGEKLNAGMGAHQRRALSTINRN 364 M G+DEN VIRP+N+QG + G KL AGMG H RRALSTINRN Sbjct: 1 MVGSDENLPGVIRPTNIQGGLHPGAGKLAAGMG-HNRRALSTINRN 45