BLASTX nr result
ID: Rauwolfia21_contig00049990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00049990 (336 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 64 2e-08 ref|YP_008802489.1| ribosomal protein L2 (mitochondrion) [Asclep... 64 2e-08 gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palm... 64 2e-08 gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium h... 64 3e-08 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 64 3e-08 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 64 3e-08 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 64 3e-08 gb|AAL48209.1|AF387188_1 ribosomal protein L2 [Ulmus thomasii] 64 3e-08 gb|AAL48208.1|AF387187_1 ribosomal protein L2 [Gossypium arboreum] 64 3e-08 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] 62 6e-08 ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 62 6e-08 ref|XP_004253315.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 62 6e-08 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 62 6e-08 gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tubero... 62 6e-08 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 62 8e-08 gb|AHC94302.1| ribosomal protein L2, partial (mitochondrion) [Am... 61 1e-07 gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella t... 61 1e-07 pir||S46947 ribosomal protein L2 - evening primrose mitochondrio... 61 2e-07 ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259... 61 2e-07 ref|YP_514664.1| ribosomal protein L2 [Oryza sativa Indica Group... 60 3e-07 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 224 EIRKWRTHSILWAHRIKRKAALSWQSFR 251 >ref|YP_008802489.1| ribosomal protein L2 (mitochondrion) [Asclepias syriaca] gi|556562328|gb|AGZ63024.1| ribosomal protein L2 (mitochondrion) [Asclepias syriaca] Length = 299 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 205 EIRKWRTHSILWAHRIKRKAALSWQSFR 232 >gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palmer 679] Length = 228 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 166 EIRKWRTHSILWAHRIKRKAALSWQSFR 193 >gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 223 EVRKWRTHSILWAHRIKRKAALSWQSFR 250 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 224 EVRKWRTHSILWAHRIKRKAALSWQSFR 251 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 224 EVRKWRTHSILWAHRIKRKAALSWQSFR 251 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 224 EVRKWRTHSILWAHRIKRKAALSWQSFR 251 >gb|AAL48209.1|AF387188_1 ribosomal protein L2 [Ulmus thomasii] Length = 246 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 196 EVRKWRTHSILWAHRIKRKAALSWQSFR 223 >gb|AAL48208.1|AF387187_1 ribosomal protein L2 [Gossypium arboreum] Length = 270 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSWQSFR Sbjct: 209 EVRKWRTHSILWAHRIKRKAALSWQSFR 236 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] Length = 331 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILW HRIKRKAALSWQSFR Sbjct: 220 EIRKWRTHSILWVHRIKRKAALSWQSFR 247 >ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like [Solanum tuberosum] Length = 340 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILW HRIKRKAALSWQSFR Sbjct: 222 EIRKWRTHSILWVHRIKRKAALSWQSFR 249 >ref|XP_004253315.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like, partial [Solanum lycopersicum] Length = 366 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILW HRIKRKAALSWQSFR Sbjct: 210 EIRKWRTHSILWVHRIKRKAALSWQSFR 237 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILW HRIKRKAALSWQSFR Sbjct: 220 EIRKWRTHSILWVHRIKRKAALSWQSFR 247 >gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tuberosum] Length = 296 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 EIRKWRTHSILW HRIKRKAALSWQSFR Sbjct: 222 EIRKWRTHSILWVHRIKRKAALSWQSFR 249 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSW+SFR Sbjct: 221 EVRKWRTHSILWAHRIKRKAALSWRSFR 248 >gb|AHC94302.1| ribosomal protein L2, partial (mitochondrion) [Amborella trichopoda] Length = 429 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 118 QVNMDKTNERKEIRKWRTHSILWAHRIKRKAALSWQSFR 2 +V KT E+RKWRTHS+LWAHRIKRKAALSWQS R Sbjct: 279 KVRGKKTFSLCEVRKWRTHSVLWAHRIKRKAALSWQSSR 317 >gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella trichopoda] Length = 632 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 118 QVNMDKTNERKEIRKWRTHSILWAHRIKRKAALSWQSFR 2 +V KT E+RKWRTHS+LWAHRIKRKAALSWQS R Sbjct: 290 KVRGKKTFSLCEVRKWRTHSVLWAHRIKRKAALSWQSSR 328 >pir||S46947 ribosomal protein L2 - evening primrose mitochondrion gi|516394|emb|CAA56451.1| 70s mitochondrial ribosomal protein L2 [Oenothera berteroana] Length = 332 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHRIKRKAALSW SFR Sbjct: 221 EVRKWRTHSILWAHRIKRKAALSWLSFR 248 >ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259156826|gb|ACV96687.1| ribosomal protein L2 [Cucurbita pepo] Length = 332 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 85 EIRKWRTHSILWAHRIKRKAALSWQSFR 2 E+RKWRTHSILWAHR+KRKAAL WQSFR Sbjct: 221 EVRKWRTHSILWAHRMKRKAALDWQSFR 248 >ref|YP_514664.1| ribosomal protein L2 [Oryza sativa Indica Group] gi|194033244|ref|YP_002000581.1| ribosomal protein L2 [Oryza sativa Japonica Group] gi|23495405|dbj|BAC19886.1| Ribosomal protein L2 [Oryza sativa Japonica Group] gi|74100083|gb|AAZ99247.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|74100138|gb|AAZ99301.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100192|gb|AAZ99354.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|353685231|gb|AER12994.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|353685298|gb|AER13060.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277621|gb|AEZ03727.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277672|gb|AEZ03777.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|528540449|dbj|BAN67503.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540486|dbj|BAN67539.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] Length = 502 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 103 KTNERKEIRKWRTHSILWAHRIKRKAALSWQSFR 2 KT EIRKWRTH +LWAHRIKRKAALSWQS R Sbjct: 161 KTFSLCEIRKWRTHCVLWAHRIKRKAALSWQSLR 194