BLASTX nr result
ID: Rauwolfia21_contig00049940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00049940 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624442.1| hypothetical protein MTR_7g083260 [Medicago ... 61 1e-07 >ref|XP_003624442.1| hypothetical protein MTR_7g083260 [Medicago truncatula] gi|355499457|gb|AES80660.1| hypothetical protein MTR_7g083260 [Medicago truncatula] Length = 757 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/45 (53%), Positives = 38/45 (84%) Frame = -1 Query: 135 RKRKTSGHIGNYFAPRTTPGSQPTLKSMLANKEAVHRVHMEVAKF 1 +KRK +G I ++FAPRTTPGSQPTLKS++++K+ +H+ M +A++ Sbjct: 130 KKRKATGEIESFFAPRTTPGSQPTLKSVMSSKQTIHKAKMAIARW 174