BLASTX nr result
ID: Rauwolfia21_contig00049849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00049849 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW21822.1| hypothetical protein PHAVU_005G101900g [Phaseolus... 79 8e-13 gb|AFK42236.1| unknown [Medicago truncatula] 77 2e-12 ref|XP_006370233.1| hypothetical protein POPTR_0001s40870g [Popu... 76 4e-12 ref|XP_002282598.1| PREDICTED: squamosa promoter-binding-like pr... 76 4e-12 ref|XP_002317486.2| hypothetical protein POPTR_0011s11770g [Popu... 76 5e-12 gb|EPS64133.1| hypothetical protein M569_10651, partial [Genlise... 76 5e-12 gb|EXC18088.1| Squamosa promoter-binding protein 1 [Morus notabi... 75 1e-11 gb|EOY13069.1| Squamosa promoter binding protein-like 3 isoform ... 75 1e-11 gb|EOY13068.1| Squamosa promoter binding protein-like 3 isoform ... 75 1e-11 ref|XP_004146058.1| PREDICTED: squamosa promoter-binding-like pr... 75 1e-11 ref|XP_004978167.1| PREDICTED: squamosa promoter-binding-like pr... 74 2e-11 gb|EOY01636.1| Squamosa promoter-binding protein-like transcript... 74 2e-11 gb|AFW59257.1| squamosa promoter-binding protein-like (SBP domai... 74 2e-11 ref|XP_003581504.1| PREDICTED: squamosa promoter-binding-like pr... 74 2e-11 gb|ADX60108.1| SBP transcription factor [Zea mays] 74 2e-11 gb|AHC08502.1| SBP-box transcription factor [Malus domestica] 74 2e-11 ref|NP_565771.1| squamosa promoter-binding-like protein 3 [Arabi... 74 3e-11 emb|CAB94233.1| Squamosa promoter binding protein-like 3 [Arabid... 74 3e-11 ref|XP_002305783.2| hypothetical protein POPTR_0004s04630g [Popu... 74 3e-11 gb|AAM67271.1| putative squamosa-promoter binding protein [Arabi... 74 3e-11 >gb|ESW21822.1| hypothetical protein PHAVU_005G101900g [Phaseolus vulgaris] Length = 169 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/85 (49%), Positives = 48/85 (56%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKHFXXXXXXXXXXXXXXXXXRIKKNQC 187 FCQQCSRFH LSEFDDAKRSCRRRLA HNERRRK+ ++K C Sbjct: 85 FCQQCSRFHELSEFDDAKRSCRRRLAVHNERRRKNSSDQSQAEGSSHKGSEAPQLKDIAC 144 Query: 186 RQAGESGRTPMGFV*EPPELQYPLR 112 QA E GRT + P + +R Sbjct: 145 VQANERGRTHITIQQNSPYKNFQIR 169 >gb|AFK42236.1| unknown [Medicago truncatula] Length = 144 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK Sbjct: 103 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 136 >ref|XP_006370233.1| hypothetical protein POPTR_0001s40870g [Populus trichocarpa] gi|550349412|gb|ERP66802.1| hypothetical protein POPTR_0001s40870g [Populus trichocarpa] Length = 196 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/68 (57%), Positives = 42/68 (61%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKHFXXXXXXXXXXXXXXXXXRIKKNQC 187 FCQQCSRFH L EFD+ KRSCRRRLAGHNERRRK +K+N C Sbjct: 112 FCQQCSRFHELVEFDETKRSCRRRLAGHNERRRK--STAESYGEGSNRKGVNTPLKENPC 169 Query: 186 RQAGESGR 163 RQA E GR Sbjct: 170 RQADERGR 177 >ref|XP_002282598.1| PREDICTED: squamosa promoter-binding-like protein 4 [Vitis vinifera] gi|302142976|emb|CBI20271.3| unnamed protein product [Vitis vinifera] Length = 204 Score = 76.3 bits (186), Expect = 4e-12 Identities = 40/65 (61%), Positives = 43/65 (66%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKHFXXXXXXXXXXXXXXXXXRIKKNQC 187 FCQQCSRFH LSEFD+AKRSCRRRLAGHNERRRK + K+NQC Sbjct: 124 FCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRK------GASESQNAEGSGGKEKENQC 177 Query: 186 RQAGE 172 RQA E Sbjct: 178 RQAEE 182 >ref|XP_002317486.2| hypothetical protein POPTR_0011s11770g [Populus trichocarpa] gi|550328182|gb|EEE98098.2| hypothetical protein POPTR_0011s11770g [Populus trichocarpa] Length = 193 Score = 75.9 bits (185), Expect = 5e-12 Identities = 39/71 (54%), Positives = 45/71 (63%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKHFXXXXXXXXXXXXXXXXXRIKKNQC 187 FCQQCSRFH L EFD+ KRSCRRRLAGHNERRRK+ ++K++ C Sbjct: 109 FCQQCSRFHELLEFDETKRSCRRRLAGHNERRRKN--TAESYGEGSSRKGVGTQLKESPC 166 Query: 186 RQAGESGRTPM 154 RQA E GR M Sbjct: 167 RQADERGRYQM 177 >gb|EPS64133.1| hypothetical protein M569_10651, partial [Genlisea aurea] Length = 112 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFHGLSEFDD KRSCRRRLAGHNERRRK Sbjct: 73 FCQQCSRFHGLSEFDDVKRSCRRRLAGHNERRRK 106 >gb|EXC18088.1| Squamosa promoter-binding protein 1 [Morus notabilis] Length = 170 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFHGL+EFDD KRSCRRRLAGHNERRRK Sbjct: 126 FCQQCSRFHGLAEFDDTKRSCRRRLAGHNERRRK 159 >gb|EOY13069.1| Squamosa promoter binding protein-like 3 isoform 2, partial [Theobroma cacao] Length = 258 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKHFXXXXXXXXXXXXXXXXXRIKKNQC 187 FCQQCSRFH LSEFD+AKRSCRRRLAGHNERRRK +++++QC Sbjct: 153 FCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRK--SSAESSTEGSSRKGMSSQLRESQC 210 Query: 186 RQAGES-GRTPM 154 RQA + R P+ Sbjct: 211 RQADDQRARVPI 222 >gb|EOY13068.1| Squamosa promoter binding protein-like 3 isoform 1 [Theobroma cacao] Length = 232 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKHFXXXXXXXXXXXXXXXXXRIKKNQC 187 FCQQCSRFH LSEFD+AKRSCRRRLAGHNERRRK +++++QC Sbjct: 108 FCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRK--SSAESSTEGSSRKGMSSQLRESQC 165 Query: 186 RQAGES-GRTPM 154 RQA + R P+ Sbjct: 166 RQADDQRARVPI 177 >ref|XP_004146058.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis sativus] gi|449517046|ref|XP_004165557.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis sativus] Length = 202 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/69 (53%), Positives = 43/69 (62%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKHFXXXXXXXXXXXXXXXXXRIKKNQC 187 FCQQCSRFH L+EFD+AKRSCRRRLAGHNERRRK + K++ C Sbjct: 116 FCQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKSSAESQGESTSRKGSAPQAQSKESHC 175 Query: 186 RQAGESGRT 160 RQ E R+ Sbjct: 176 RQLVEDQRS 184 >ref|XP_004978167.1| PREDICTED: squamosa promoter-binding-like protein 7-like [Setaria italica] Length = 401 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH +SEFDDAKRSCRRRLAGHNERRRK Sbjct: 165 FCQQCSRFHAISEFDDAKRSCRRRLAGHNERRRK 198 >gb|EOY01636.1| Squamosa promoter-binding protein-like transcription factor family protein, putative [Theobroma cacao] Length = 511 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/37 (89%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK-HF 259 FCQQCSRFHGL+EFDD KRSCR+RLAGHNERRRK HF Sbjct: 212 FCQQCSRFHGLAEFDDGKRSCRKRLAGHNERRRKLHF 248 >gb|AFW59257.1| squamosa promoter-binding protein-like (SBP domain) transcription factor family protein [Zea mays] Length = 450 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH +SEFDDAKRSCRRRLAGHNERRRK Sbjct: 187 FCQQCSRFHAISEFDDAKRSCRRRLAGHNERRRK 220 >ref|XP_003581504.1| PREDICTED: squamosa promoter-binding-like protein 7-like [Brachypodium distachyon] Length = 318 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH +SEFDDAKRSCRRRLAGHNERRRK Sbjct: 112 FCQQCSRFHAMSEFDDAKRSCRRRLAGHNERRRK 145 >gb|ADX60108.1| SBP transcription factor [Zea mays] Length = 399 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH +SEFDDAKRSCRRRLAGHNERRRK Sbjct: 136 FCQQCSRFHAISEFDDAKRSCRRRLAGHNERRRK 169 >gb|AHC08502.1| SBP-box transcription factor [Malus domestica] Length = 168 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH LSEFDD+KRSCRRRLAGHNERRRK Sbjct: 122 FCQQCSRFHSLSEFDDSKRSCRRRLAGHNERRRK 155 >ref|NP_565771.1| squamosa promoter-binding-like protein 3 [Arabidopsis thaliana] gi|67461216|sp|P93015.2|SPL3_ARATH RecName: Full=Squamosa promoter-binding-like protein 3 gi|2462081|emb|CAA70578.1| squamosa-promoter binding protein like 3 [Arabidopsis thaliana] gi|5931651|emb|CAB56579.1| squamosa promoter binding protein-like 3 [Arabidopsis thaliana] gi|5931663|emb|CAB56585.1| squamosa promoter binding protein-like 3 [Arabidopsis thaliana] gi|20198315|gb|AAC69133.2| putative squamosa-promoter binding protein [Arabidopsis thaliana] gi|26451405|dbj|BAC42802.1| putative squamosa-promoter binding protein [Arabidopsis thaliana] gi|28973077|gb|AAO63863.1| putative squamosa-promoter binding protein [Arabidopsis thaliana] gi|330253795|gb|AEC08889.1| squamosa promoter-binding-like protein 3 [Arabidopsis thaliana] Length = 131 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH LSEFD+AKRSCRRRLAGHNERRRK Sbjct: 94 FCQQCSRFHALSEFDEAKRSCRRRLAGHNERRRK 127 >emb|CAB94233.1| Squamosa promoter binding protein-like 3 [Arabidopsis thaliana] Length = 129 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH LSEFD+AKRSCRRRLAGHNERRRK Sbjct: 92 FCQQCSRFHALSEFDEAKRSCRRRLAGHNERRRK 125 >ref|XP_002305783.2| hypothetical protein POPTR_0004s04630g [Populus trichocarpa] gi|550340326|gb|EEE86294.2| hypothetical protein POPTR_0004s04630g [Populus trichocarpa] Length = 148 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH LSEFDD+KRSCRRRLAGHNERRRK Sbjct: 104 FCQQCSRFHDLSEFDDSKRSCRRRLAGHNERRRK 137 >gb|AAM67271.1| putative squamosa-promoter binding protein [Arabidopsis thaliana] Length = 131 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 FCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRK 265 FCQQCSRFH LSEFD+AKRSCRRRLAGHNERRRK Sbjct: 94 FCQQCSRFHALSEFDEAKRSCRRRLAGHNERRRK 127